KEGG   Arthroderma benhamiae: ARB_03447Help
Entry
ARB_03447         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
abe  Arthroderma benhamiae
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1417 aa AA seqDB search
MTQEVERTPGSSQSKTVRVSFEATADPQASNLGIQPSTSSNGGHHRSATSGAVQFPSSSR
SIDDAGQDSHSSANESRPRSRPNINGNRRKPALIRAKSEHWHDLGPDVRALGGEEEDVQL
RHGWQEEYTSSEYLKILNSNFYMYFTEKRHDTNGIPKQPDEVWRSQDWRMRDRLKTVSAA
LAICLNIGVDPPDVVKTNPSAKLECWVDPTSTTGAQNKVMEQIGKKLQEQYETLSLRTRY
KQYLDPSVEETKKFCISLRRNAKDERVLFHYNGHGVPLPTPSGEIWVFNKNYTQYIPVSL
YDLQTWLAGPSLFVFDVSHAGNIVQNFHAFLEKHEKENAEARKRDPIASLQNYGDCILLA
ACEKNETLPTNPDLPADLFTCCLTTPIEIALRYFVLQNPLQTSLSVDEFRVPGRLQDRRS
PLGELNWIFTAITDTIAWNTLPRPLFKKLFRQDLMVAALFRNFLLSERIMRTHECHPISS
PKLPITHTHPLWQSWDLAVEMVLAQLPALIEQEEGTRHYEYQHSPFFAEQLTAFEVYLSS
GPTEKNPPDQLPIVLQVLLSQAHRLRALILLSGFLDLGPWAVHLALSIGIFPYVVKLLQS
AAQELKPVMVFIWARIMAVDHTVQNDLLKDNGIHYFITILHPNSPIPVANVSDHRAMCAF
IVAIFCKQYPQGQHVCLSPELIEACLTHLLDTENPLLRQWSCLCLSMLWNDFPEAKWMGI
RASAPPKLCELAADPVPEVRAAMLHALTSFIGIPDLTDQVAQIEEYLAMAVLPMGSDGSV
LVRKEFLVFVSTFVKRYQNKFIVAAYEQLLEEKQVLTTQPTGSPLMSPPQPSENGVSQGT
VIGSIWKLVLILSVDPHPDVAQDGGIIVDYVHKTLLESPLGGLARKAREDILELYTRAQS
KKTQQQESIDNARPKTPPSQQAPKPEGYLSLSLRRTASVAASLKNMAFGSSSNSPQPPGS
PNSTTFAKPQVPKGRVTVTPRGRAPAEWTRPPEVNDQRASARSYQQAPTPSSRGFKLRDV
KEEPVIPLVSQFLDWSTEYFREPQMKPNEPDEPGSSDYNERLWRRGRNERIIVETQPMKT
RAGSSRWDNSVSLINNSTQPMKMCFHQFEDHLAVADDRDTICIWDWQSNTYLNRFSNGNP
LGSKINEVRFINEDDQALLMTGSSDGVLKLFRSYESSKNVKVLTAFRALPELIPSNKNAG
LVLEWQQGQGKALVAGDVKVIRVWNAATEVCTTDISARSGSCITSLTSDQVAGNIFVAGF
GDGAVRVFDQRLKPTTAMVKVWREHKQWITNVHMQRGGVRELVSGSRNGEVRLWDLRMDH
SIESTQATKDTLRTLGVHEHAPVFTMYVCPYLINFFGAKLICVLLAEPIAVKSRHSMLTA
LIYLPSNLIAAFCTIPDPPQSSALYSILIKCSWLARL
NT seq 4254 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaggaggtagagagaactcctggctcgagccagagcaagacggtccgagtgtct
ttcgaggctaccgccgaccctcaagcttccaatctgggcatccaaccgtctacgtctagc
aacggaggtcaccatagatcagccaccagtggcgccgtccagttccctagtagttcgagg
tcaattgatgacgctggacaagactcacattcctctgcgaacgagtcgaggccgcgctcg
aggcctaatatcaacggcaacaggcggaagcctgctctgattcgggcaaaaagtgaacat
tggcatgaccttggtcccgatgtcagggctttaggaggtgaggaagaagatgttcagctc
cgccatggctggcaggaggaatacacctccagtgaatacttgaagatcttgaactccaac
ttttacatgtattttactgaaaaacgacatgataccaatggcatcccgaaacaaccggac
gaggtctggagaagccaggattggcgcatgagagatagactgaagactgtctccgctgca
cttgctatttgcctcaacatcggagtagatccaccagacgtagtcaaaacaaacccctca
gcgaaactcgaatgctgggtagatccaacttccacgaccggagcgcagaataaggttatg
gaacagattggaaagaagctacaggagcagtatgaaacactcagtctgcgcacacgatac
aagcagtacttggacccctcggtggaggaaacgaagaaattctgtatttccctccgacgg
aatgcaaaggatgaaagggttctctttcattacaacggtcacggagtcccgctgcccaca
ccttctggcgaaatctgggtattcaacaagaactacactcaatatatccctgtctccctt
tacgacctgcagacatggcttgctggtcccagcttgtttgtattcgatgtttctcatgcg
ggtaacattgttcaaaacttccatgcctttctcgaaaagcatgagaaggaaaatgcggaa
gctcgcaagagagatcctattgcatccctccaaaattacggcgattgcattctccttgct
gcttgtgagaaaaacgaaaccttgccaacaaaccctgacctccctgcagacttattcacc
tgttgtcttaccacccctatcgagatagccttgaggtactttgtgcttcaaaatccactg
caaacaagtctttctgtggatgaatttagggttccgggacgcctacaggatagaagaagt
ccgctgggcgaacttaattggatattcacggcaattactgataccattgcttggaacacc
cttcctcgccccctattcaagaagctcttccgacaagacctcatggttgctgctttgttc
cggaatttcctactcagcgaacgtatcatgagaactcacgaatgtcatccaatttcttca
ccgaaactgcccattacacatactcacccgttgtggcagagctgggatttggctgttgaa
atggtcctggctcagcttccggctctcattgaacaagaagaaggcactagacactacgaa
taccagcattccccattctttgctgagcaacttacggcttttgaggtgtacctctcttcc
ggacctacagaaaagaacccgccagatcaactccctattgtcctccaggttttgctcagt
caagctcaccggttaagggcgttgattctcttgagtgggttccttgacctcggcccttgg
gctgttcacctcgctcttagcatcggtatattcccttatgttgtcaaactactccaaagt
gctgcccaggagcttaagcctgtcatggtcttcatctgggctaggataatggcagtcgat
catacagtacagaatgatctcctcaaagacaatggcatccactactttatcaccatactc
catcctaattctcccatacccgttgcaaatgtcagcgatcacagagccatgtgtgcattt
attgttgctatcttctgcaagcagtaccctcagggacagcatgtttgtttgtccccggaa
ctaattgaggcatgtttgactcacctattggatactgaaaaccccttactacggcaatgg
tcatgtttatgcctcagtatgttgtggaatgacttcccagaggcaaagtggatgggtatt
cgtgcttctgcgccacccaaactctgcgaacttgcagccgaccctgttccagaagttaga
gcagcaatgctccatgccctcaccagcttcattggcatcccagaccttaccgatcaagta
gcccagatcgaagagtatcttgctatggcagtgctcccaatgggctctgatggtagcgtt
cttgtgcgaaaggaattcctggttttcgtatcaacttttgtcaagagatatcaaaataaa
ttcatagttgcagcatatgagcagctactggaggagaagcaggtcctaacaactcaaccc
actggatccccgctaatgtcccctcctcaaccatctgagaatggtgtttctcaaggtact
gtgatcggttcaatttggaagctggttcttatcttatctgtcgatccgcatccagacgtc
gcgcaggacggcggcataatcgttgactatgtccacaaaactcttctagaatcaccgctg
ggtggtttggctaggaaagcaagggaggacattcttgaattatatacccgcgcccaatca
aagaaaacacaacaacaggagtccattgataacgctagacccaagacccctccgagccaa
caagcacccaagccagaaggatatctctccctaagtctaagaaggacggctagtgtcgct
gcatcccttaaaaatatggcgtttggctcttcatcaaatagtcctcagcctccaggctcc
cccaactccactacgtttgctaaaccccaagtgccgaagggccgtgttacggttacgcct
aggggtcgcgcacctgctgagtggactaggcctccagaggtcaatgaccagcgtgcctct
gctagatcataccaacaagcacctaccccatcttctagaggatttaaacttagagatgtg
aaagaagaacctgttattccattggttagtcagttcttagattggtcaacagagtatttc
cgagagccccaaatgaaacccaatgaaccggatgagcccggtagttcagactataacgaa
cgcctctggcgacgaggcaggaatgaaagaatcattgttgaaacgcagccaatgaagact
cgagctggtagttctcgctgggataactcggtttctctcataaacaactccactcagcca
atgaagatgtgtttccaccaattcgaagaccatcttgcagtggctgacgatagggacaca
atatgtatctgggattggcaatcaaatacatatctcaatcgattctcgaatggcaaccct
ctagggtcaaaaattaatgaagtccgtttcattaacgaagatgaccaagctcttttaatg
acaggctcctctgacggcgtattaaagctattccgcagctacgaatcgagtaaaaatgtc
aaggttctcacagcgttccgcgcgctgcctgagttgatacccagtaataaaaatgctgga
ctcgtccttgagtggcaacaaggtcaaggtaaagcgctagtagcgggggatgtgaaggtt
atccgagtctggaatgcggccactgaagtttgcacaacagatatatctgctcgctccgga
tcatgcattacgtccctgacctccgaccaagtagcgggtaacatattcgttgcaggattt
ggcgatggtgcagttcgtgttttcgaccagcgcctaaaaccaacgacggcaatggttaag
gtctggagggaacacaaacagtggattaccaacgtacacatgcaacgaggcggagtcaga
gaattggtctccggtagccgcaatggtgaagtccgactctgggatctaagaatggatcac
tcaatcgaatcaacgcaggcaaccaaagacaccctgcgtaccttaggtgttcatgaacac
gccccggttttcaccatgtatgtctgtccctatctcatcaacttctttggagctaaacta
atatgcgtcttgttagcggaaccaatcgccgtgaagtcaagacattcaatgttgacggca
ctcatctatctaccttcgaacctcatagcagctttttgcaccatacccgatcctccccag
tcgtcagcactgtattccatcctcataaaatgctcctggcttgctcgactctaa

DBGET integrated database retrieval system