KEGG   Arthroderma benhamiae: ARB_03805Help
Entry
ARB_03805         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K01855  
tRNA pseudouridine38/39 synthase [EC:5.4.99.45]
Organism
abe  Arthroderma benhamiae
Brite
Enzymes [BR:abe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.45  tRNA pseudouridine38/39 synthase
     ARB_03805
Transfer RNA biogenesis [BR:abe03016]
 Eukaryotic Type
  tRNA modification factors
   Psudouridine synthases
    ARB_03805
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 409 aa AA seqDB search
MDSVVATKSGMSDRNTQSGVSDTGEAKGWDDIADELPYIQILNGALPEDIRVLAWCPHLP
PDFDARFSCRQRRYRYFFTQPAFCPTPGARGIVRSSELKDDLSLERPREGWLDIEAMREA
AQYFVGSHDFRNFCKVDTSKQITNFVRRILRADIELVDPQRTPLGFVQMPGFEPFENGSR
NTGVPENINDINPAAGKVYSFTVHGTAFLWHQIRHMVGILFLVGQGLEHPSIVPELLDVT
KNPRRPVYEMASDSPLVLWDCIFGEEEDELDWVYPGDPRTLKSPSRRTDGNFGQGGLVED
LWTLWRNRKIDELLAGTLLESMANRGQSIAASKGDDHPSNQVQAVRSPRVFSGGDNGKPI
GKYVPLLNRTKLDLVEDMNARYLSKKGHKYWNKVLEYQEEQRKAALDGE
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggattcggtcgttgcaaccaaatcgggtatgagcgatagaaatacacaaagtggtgtc
tctgatacaggagaagccaagggatgggatgatattgcagacgagttaccctatatacag
atcttgaatggcgctttacctgaggatatacgagttcttgcgtggtgccctcatttacct
cctgattttgacgcacgcttttcatgtcgccaaagaaggtaccgttacttctttacccag
cccgcattttgcccaactcctggtgctagaggcatcgtcagatcttctgaattaaaagat
gatttatctttagagaggccaagagaaggatggctggatatagaagctatgcgggaagca
gcacaatattttgtgggcagtcatgactttcgaaatttttgcaaagttgatacgagcaag
caaataacaaattttgtgcggcgtattttacgtgcggatatagaactcgtggaccctcag
agaaccccgcttgggtttgtgcaaatgcctgggtttgaaccttttgaaaacggctctaga
aataccggggtccccgaaaacattaatgatatcaacccagcagccggcaaagtgtattca
ttcacagtgcacggtacagcatttttatggcatcaaattcgtcatatggttggaatctta
tttcttgttggtcaaggccttgaacatccatctatagttcctgagctattagatgtcaca
aaaaacccgcgacggccggtgtatgagatggcttcagactcccctcttgttctctgggac
tgtatatttggagaagaagaggatgaattagattgggtctatccaggtgatccacgaact
ttgaagtctccgtcgcgtaggacagatggcaactttggtcaaggtggtcttgttgaagac
ttatggaccctctggaggaatagaaagatcgatgagttgctggctggtacattgttggaa
tccatggcgaatcgaggtcagtcgattgctgcttcgaaaggagatgaccatccgtcaaat
caggtacaggcagtacggagtcctagggtttttagtggaggagataatgggaaacccatc
ggaaaatatgtaccactgttgaacagaacaaaacttgaccttgtcgaggacatgaatgcc
cggtatttgtcaaaaaaagggcacaagtattggaacaaggtcctagaataccaggaagag
cagcggaaagcagcactcgatggcgaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system