KEGG   Arthroderma benhamiae: ARB_03851Help
Entry
ARB_03851         CDS       T01611                                 

Definition
agmatinase, putative
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
abe  Arthroderma benhamiae
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:abe00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 433 aa AA seqDB search
MVYLKYKTLAVAGAILSAQVVDCHSRHGEEQIPLSQEELEHKWAPELSAFATMGSFGGLK
HVPCLTKPNELYDIAIIGAPFDTATSYRPGARFGPRAIREASGRQVAARSYNVRAGINPY
LDWAKVIDCGNIPITQMDNRIAEKQMFEAFLELGTRKAAYQPQEKGDKPKRQARISDGKP
KLVTLGGDHSIILPALRALNQIYKKPITVIHFDAHQDTWESSRYDGYWKPDVDGLNHGTW
LFHAGQEGLISNTTSAHAGLRSYLGGSDDRDYRTGVEKGFMRIHADDVDDIGTQGVVDAI
VSRVGLDPDQPVYISLDIDVLDPSIAPGTGTPESGGWTSRELARILRGLEKLNVVGADVV
EVSPSYDHRAGGTALAAAHVVNEIIASMVKLGVEDPGTVGGWFGRKGNKSVKEGVMESYQ
EGAAGSEARKDEL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggtgtacttgaaatacaagacgcttgctgtggctggagccatactcagcgctcaagtg
gtggactgtcatagtcgccatggcgaggaacagataccgctgagccaggaggaactagag
cataaatgggcaccggagttgtctgcatttgcgaccatgggcagctttggtggacttaag
catgtcccatgcctgacaaagccaaatgagctttacgacattgccatcattggagcgccg
ttcgacacagcgacttcataccggcccggagcacggtttgggcctcgggcaatccgtgag
gccagcggccgccaggtcgcagcccgttcatacaatgtccgagctggtatcaacccttac
ttggactgggccaaagtcatagactgcggaaacatccccatcacgcagatggacaatagg
atagcagaaaagcaaatgttcgaagccttcctagaactcggcacgaggaaggctgcctac
cagccgcaagagaagggcgacaagcccaagagacaagcgaggatatcagacggaaagccc
aagctcgtcactcttggaggagaccacagcatcatcctgccggcgctgcgagcgctgaac
cagatctataaaaagccgatcaccgtcatccacttcgatgcgcaccaggacacgtgggaa
tcctcccgttacgacgggtactggaagccagacgttgatggtctcaaccacggaacctgg
ctgttccatgcgggccaggaagggctgatttcaaacaccacgtctgcccacgcggggctg
cgatcctatctcggcggatctgatgatagagattaccgtaccggggtagagaaagggttc
atgcgcatccacgcggatgatgtcgatgacattggcactcagggggtggtcgatgcgatt
gtctcgcgagtcggtctcgacccagaccagcctgtctacatcagtttggatatcgatgtt
cttgaccccagcattgcgcctggaacaggcacgccggagtcaggtggctggacgtccagg
gagcttgctaggatcctccgcgggctggagaagctgaatgtggttggggccgatgtggtg
gaggtctcgcccagctatgatcatcgtgcgggagggactgctcttgcggctgcgcatgta
gtcaacgagatcattgcaagcatggtgaaactcggagttgaagatccaggcacagtcggg
ggctggtttggtagaaagggcaacaagtccgtcaaggagggtgtgatggagtcatatcaa
gagggcgcagcaggctcagaagcccgaaaagacgagctttga

DBGET integrated database retrieval system