KEGG   Arthroderma benhamiae: ARB_03883Help
Entry
ARB_03883         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
abe  Arthroderma benhamiae
Brite
Enzymes [BR:abe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     ARB_03883
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 524 aa AA seqDB search
MGVPEGPQEAVGTPDPADRGFATLNTLSIGVKVFVVKDGEQRKAEILSIKQKKGGPTFYV
HYVDFNKRLDEWIPASRIDLTKEVEWPQPEKPEKKKISGAAAAAAATKAQPKNLKRGQHA
SRDASSTPDLLSGKNQNISKAPRPSKAGGKENQEDESGTPFEISMLGSEGPSMSGTPRVR
DGESEDVEMADIQSEVEAKAALKEEQDKLAADATREVEIEKLRTGGSMTQNLTEIHRVRN
LSKIQMGKFEIEPWYFSPYPTSFSDADMIYIDEFCLSYFDNERAFRRHRSKCTLLHPPGN
EIYRDDHVSFFEVDGRRQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTTRDANGCHL
VGYFSKEKESAEGYNVACILTLPQYQRRGFGRLLIAFSYELSKREGKLGSPEKPLSDLGL
LSYRQYWRETLVELLVEPGRDAISESELATLSAMTEKDVHETLVVLGLLRYNKGNWVLVL
TDSVMEQHKKRLEKEKIKGARNIDPSRLQWKPPVFNASSRTWNW
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtcccagaaggcccccaggaggctgttggaacgccagaccccgcggatagaggt
tttgccaccttgaataccttgagtatcggagtaaaggtgtttgtcgtcaaagatggagag
caacgaaaagcggagattctttcaataaagcagaagaaaggagggccgaccttctatgtc
cattatgtggacttcaacaagcgtcttgatgaatggattcctgcatcaagaatcgatctt
actaaagaagttgaatggccccagccggagaaacctgaaaagaagaaaatatcaggggcg
gctgcggctgcggctgctaccaaggcgcaaccaaagaatctcaagcgaggacagcatgca
agcagagatgcttcatcaactccagatctgctgtctggtaagaaccagaacatttcaaag
gccccaagaccttcaaaggctggaggcaaagaaaatcaggaagatgaaagtggtacacca
ttcgagatatccatgcttggcagcgaggggccatccatgagtggcacacctcgagttcgt
gatggagagtcagaagacgttgaaatggccgatattcaatctgaggtcgaggcgaaggcc
gctctgaaggaagaacaagacaagctcgctgctgacgcaacccgggaagtcgaaattgaa
aagttaagaacagggggtagtatgactcaaaatctaacggagatccaccgtgtacggaac
ttgagtaagatccaaatgggtaaattcgagattgagccgtggtacttctctccttatcct
acgtccttcagtgatgccgatatgatatacatcgacgaattctgcctcagctactttgac
aacgaacgtgcgttccgcagacatcggagcaagtgcaccttactacatccaccaggaaac
gagatataccgggatgaccatgtttcattttttgaagttgacggcagacgacaaaggaca
tggtgcagaaacctctgtctactcagcaagctgtttttagaccacaagacgttatactac
gatgtcgatccattcctattctactgtatgactacgcgggatgccaacggatgccatctt
gtcggatatttttccaaggaaaaggagtctgccgaaggatacaatgttgcatgcatcctg
actttgcctcagtaccaacgtcgtgggtttggtcgactgcttatcgccttcagctatgag
cttagcaagcgggaagggaagctaggttctcctgaaaagcctcttagtgacctaggttta
ctgagctatcgtcagtattggagggaaacgcttgttgaacttcttgtcgagccaggccga
gacgcaattagcgagagcgagttagctacgttaagtgcgatgactgaaaaggatgttcat
gagacattagtggtgctaggattgctacggtataataaaggaaattgggtcctggtgtta
acggatagcgtgatggagcaacataagaagcgtctcgaaaaagagaaaatcaagggtgcg
aggaatattgacccttcacgtctccagtggaagccaccggtcttcaatgcctccagtaga
acatggaactggtaa

DBGET integrated database retrieval system