KEGG   Arthroderma benhamiae: ARB_03892Help
Entry
ARB_03892         CDS       T01611                                 

Definition
ribosome biogenesis protein Urb1, putative
Orthology
K14861  
nucleolar pre-ribosomal-associated protein 1
Organism
abe  Arthroderma benhamiae
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1131 aa AA seqDB search
MASFDDNAARAKRRKIDGDATIPVTAEITSYQQLRDILRFQQNISQETKQGIRHFKEFLA
SIQGDISEAEKSKKLQVLQKYCASQYVKRGDETPPICFTDLVSIWNFAESNNEESTLSLI
PSVLASFLKTISSQLEFREFSIELSKYLLSNENIKLINRGLTASKSKEHLISPCLRLLTE
IVSFDGGAVAKVVYAKRDITLKRLDVFLTMRKLQAGEIAADRRKPTLRRIAQRYLLANLR
YQSPAAKAELLSQGKLIKVFIEDIKRDSGDIVVDIIKTLDKFVVSDPVLSRSVKSRLLSR
WNLERFATLYGYEKDSEEFMPEGVSVSDEIHKFLLLVCTNVDKGVLLSDNGWYSSGNSTE
PLINDTETISLGLDAPSHFDKFNETIPIRNGNLSTLIQFLRPESDTRQMQLLLKIFRAAP
ELVYDYFSKRNMFNSDPKPTQAWLGESAFLFSIIQLPVPQKCGFREGSPAVPPPVSVAIE
SILPRPLTQKMLTRCMNQNTEIVTLFAIKATTAALRKLRGVLKVFDSMGSSNPELWSQAS
TKLMNEFTSRCPTMKDTIIAFRQSPKDDLLQRDALLELLSLYYQVAPTVAFEQKLDVSLV
LVEVLDQLSNDELSTENRQLLFSQLQHTLAISQHSPAMRWWQKPAPLTLSVFTSVLKVAV
EKQDHSARAKIYSLLQDVLTQDSILVQPDSFEALVLSIQLEDENIPLPWSFIDNCFTRLA
KRPVPYLDQVSSLPSKSSLISPILVVISEQWPFIVKAQDEMNELSTAAWISKLLGYLKEY
GEDKNALTSVRDTILSETKVKKCRSLLKKAFDHGIETHRLVLGEEDTQMGGTGTLPSPSA
TQEVNLSDVFGEIQMADETHAGLHKWEREDLELAIDQGYIGDLILCVCSEHEEVRRQAMA
GLSRFMAKLKESSFEERQAIYILIGELLETVKGLGLDTPAPFIVGELAVRMLAILTNPSH
KLYGKINTFLNRSPQWEVGKIPSYWIDKILYHEPESDDGNHEEIGWLLDLFVCGLKSELD
MDIYRRAGVFERLFSLYSSPALTGGLRKKVLHLVYRVCEIGGSTTLITRAAALSWVQGQA
AISDAHSSTLRALATELYRTSSSEWVDRWSGSALAAAVMSTGASSVQQLAC
NT seq 3396 nt NT seq  +upstreamnt  +downstreamnt
atggctagtttcgatgataatgccgcccgggctaaacggagaaagattgacggtgatgct
actattcctgtaactgctgaaattacttcctaccagcaattaagagatattttgaggttc
cagcaaaacatatcacaagaaacaaagcaagggattcgtcactttaaagaatttttggct
tctattcaaggggacatctctgaagctgaaaagtcaaagaaactccaagtcttacaaaaa
tattgtgcttctcaatatgtcaaaagaggagacgaaaccccccctatttgcttcactgat
cttgttagcatttggaactttgcagagagcaataatgaagagtcgacactttcgcttata
ccctcggttctcgcatcattcctgaaaaccatttcttcccagcttgagttcagggaattt
tcaattgagcttagcaaatacttgctatccaatgaaaacatcaaacttatcaaccgtggc
cttactgcaagcaagtcaaaagagcatttgatatcgccttgtcttaggctgctgactgag
atcgtgagctttgacggtggggccgttgcaaaggtagtctatgctaaacgagatatcacg
ctgaaaaggctcgatgtgtttcttactatgcgtaagttacaggcgggggaaatagctgcg
gatcgacgtaagcccacgctccgccgtattgcccagcgctacttgcttgcaaatctaaga
tatcaaagccctgcagctaaagctgagctattgagtcagggaaaacttataaaggtattc
attgaggatattaagcgagattcaggggacatagttgtggatattatcaagacattggat
aaattcgttgtatcggatcctgttctctcccgcagtgtcaagagccgcctcttaagtcga
tggaacctggaacgattcgcgacactctatgggtacgaaaaggactctgaggaatttatg
ccggaaggtgtgtcggtttctgacgaaatacacaagtttttactactggtttgcacaaac
gtcgacaagggtgtcttattatcggataatggttggtactcgtcaggcaacagtacagaa
ccactgatcaacgataccgaaaccatctctcttggacttgatgcaccaagccacttcgac
aaatttaacgaaacaatacctatccgtaatggaaacctttcaactttgattcagttcctt
cgccccgaatcagacactcgacagatgcagttgctactaaaaattttccgagccgctcct
gagctagtatatgattacttctcgaagcgcaatatgtttaattccgacccaaagccgaca
caggcctggcttggagagtccgcctttttattctctattatccagttgcctgtgcctcaa
aaatgcggcttcagggaaggctcacctgcggtgcctcctccggtatctgtcgctattgag
agtatcctcccgcgccctcttacgcaaaaaatgttgactcgctgtatgaaccagaacact
gaaattgttacgttgtttgcgatcaaggcaacaacagcggctcttcgaaaacttcgaggt
gtgctaaaagtgtttgactccatgggaagctcaaatccggaactctggagtcaggcgtct
acaaaacttatgaatgagttcacttccagatgtcctacgatgaaagataccattattgcc
ttccgtcaatccccgaaggatgacctgctgcagcgagatgcgcttttagagctgctttcc
ttatactaccaagtcgctccaactgtagcttttgaacaaaagctcgacgtgtcattggtt
ttagtcgaagtcctggaccaactgagcaatgacgagttatctacggaaaaccgtcaacta
ttattcagccaattgcagcacaccctagcaatttctcaacattcgcctgctatgcgctgg
tggcagaagccagcacccttaaccttatcggtatttacctcagtactaaaagttgctgtg
gaaaaacaggatcatagcgcccgggccaaaatttactcccttctacaagatgtcttgacg
caggattcaatcttggtacaaccagattcattcgaagccctggtgcttagtattcagttg
gaagatgagaatattcctctgccctggtctttcattgataattgctttacaagacttgcg
aaacggccagtcccatatcttgaccaagtgagctcattacctagcaagtcatcattgata
agtccaattttggtagtgatttcggaacaatggccctttatcgtgaaagctcaagatgag
atgaacgagctttccacggctgcgtggatttccaaattactcggttatttgaaggagtat
ggagaagataagaatgcgcttacctccgtccgtgacacgattttgagtgaaactaaggtg
aaaaagtgccgctcgttgcttaaaaaggcttttgatcatggtatagaaacgcaccggctt
gttctgggtgaagaggatactcaaatgggtggtactggaacccttccatcgccatcagct
acccaggaagtgaacctttcagatgttttcggcgaaatacagatggctgatgagactcat
gctggcttgcacaaatgggaaagagaagaccttgaactagcaatagaccaagggtatatc
ggagatctcatactttgcgtctgctctgagcatgaagaagttcggcgtcaagctatggct
ggtttatcacgcttcatggcaaaactcaaggaatcctcgtttgaagagcgtcaggcaata
tacatactcattggcgaattattggaaacagtgaaggggctaggccttgacacaccagca
ccttttattgttggagaacttgcagttcgcatgctcgctattctcacgaatcctagtcac
aagttatacggaaagatcaacactttcctgaacaggagccctcaatgggaggttgggaag
atcccctcgtattggattgataaaatactctaccacgagccagagagcgatgatggcaac
catgaagaaattggctggctgctagatttatttgtttgcgggcttaaatctgaactggac
atggacatatatcgacgagccggcgtctttgagcggctgttctccctgtatagttcccca
gcattaacaggaggactgcggaagaaggtccttcacttggtatatcgtgtttgtgaaatc
gggggcagcacgacactgatcactcgggctgctgccctcagttgggtgcaaggccaagca
gcgatatccgacgcccacagcagcacactgcgagcccttgcaacagagctgtaccgtacc
agttccagcgaatgggttgatcgctggagtggctctgcgttggcagcggctgttatgtcg
acaggggcctcgagcgtacagcagttggcgtgctga

DBGET integrated database retrieval system