KEGG   Arthroderma benhamiae: ARB_03925Help
Entry
ARB_03925         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
abe  Arthroderma benhamiae
Pathway
Basal transcription factors
Nucleotide excision repair
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:abe03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:abe03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 386 aa AA seqDB search
MVTEPFSTSLRQALMGEDQQGSFGVISVTPDKYPVSVADLDEYARQQWEAVLGYMVGMSS
LSGGRETITLSKGVKQLLQACHLVEVRDRRVEITKEGFAFVLQDVNTQVWHILILYVENA
EAIGMESVEVLSFIFLLSSLELGQSYEKKDLTPTQLRTLADLTDFGIVYQHTPASGSTRF
YPTRLATTLTSDSLAMSGPISGEPAVPTTTAGTTTSGDAGTGFIIVETNYRLYAYTSSPL
QISLISLFTTLKFRFPNLITGKITRQSVRRAIEMGITADQIISYLTTHAHPQMRKTKKST
SNVSSSVLPPTVVDQIRLWQLERDRIKATSGFLFKEFDTFAEFEAPCKYAEEIGVLVWKS
DSRRMFFVTRHEQVAAFLRSRAASRG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggtcaccgaaccgttttccacttctttgcggcaagctctcatgggagaagaccaacag
ggctcgtttggagttatatcagtgactcccgacaagtatccggtctccgtcgcggattta
gacgaatatgcaagacagcaatgggaggcggtgcttgggtacatggttgggatgagctcg
ttgagcggaggacgggaaaccataactctcagcaaaggggtgaagcagcttcttcaggcc
tgccatctggtggaagtccgagatcggagagttgaaattacgaaagaaggatttgccttt
gttctacaagacgtcaatacccaggtctggcatatactcatcctctatgtcgagaacgca
gaagctataggcatggaaagcgttgaggttctctcgttcattttcttgcttagtagcctt
gagctcggccagtcttatgagaaaaaggacctcactcccacacagcttcgaacacttgcc
gatctcactgattttggcatcgtctaccaacatacgcctgcttctgggtccacccgattc
taccctacccggctggctactacacttacgtctgactctttagctatgtcaggcccaata
tcaggagaacctgcggtcccgaccacaactgcaggtactacgacgtccggtgatgcaggc
accgggttcatcattgttgaaacaaactaccgtttatacgcatacacatcatcccctcta
cagatatctctcatatccctctttaccactctaaaattccgatttccgaatcttattacc
ggcaaaataacccgtcaatccgtccgccgagccatcgaaatgggtatcacggctgatcag
attatatcatatctcaccactcatgcccatccacagatgcgcaagacgaaaaaatctacg
tcaaacgtttcttcttcggtcttgccacctactgttgtcgaccaaatacggctttggcag
ctggaacgagatcgaatcaaagcaacatcagggtttcttttcaaggaattcgacaccttt
gcggaattcgaagctccttgcaagtatgctgaagaaatcggtgtcttggtttggaaatct
gattcaaggaggatgttttttgttaccagacatgaacaggttgctgcgttcctacgtagc
agagcggcgtcaaggggttaa

DBGET integrated database retrieval system