KEGG   Arthroderma benhamiae: ARB_03925Help
Entry
ARB_03925         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
abe  Arthroderma benhamiae
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:abe00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    ARB_03925
  Replication and repair
   03420 Nucleotide excision repair
    ARB_03925
Transcription machinery [BR:abe03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     ARB_03925
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 386 aa AA seqDB search
MVTEPFSTSLRQALMGEDQQGSFGVISVTPDKYPVSVADLDEYARQQWEAVLGYMVGMSS
LSGGRETITLSKGVKQLLQACHLVEVRDRRVEITKEGFAFVLQDVNTQVWHILILYVENA
EAIGMESVEVLSFIFLLSSLELGQSYEKKDLTPTQLRTLADLTDFGIVYQHTPASGSTRF
YPTRLATTLTSDSLAMSGPISGEPAVPTTTAGTTTSGDAGTGFIIVETNYRLYAYTSSPL
QISLISLFTTLKFRFPNLITGKITRQSVRRAIEMGITADQIISYLTTHAHPQMRKTKKST
SNVSSSVLPPTVVDQIRLWQLERDRIKATSGFLFKEFDTFAEFEAPCKYAEEIGVLVWKS
DSRRMFFVTRHEQVAAFLRSRAASRG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggtcaccgaaccgttttccacttctttgcggcaagctctcatgggagaagaccaacag
ggctcgtttggagttatatcagtgactcccgacaagtatccggtctccgtcgcggattta
gacgaatatgcaagacagcaatgggaggcggtgcttgggtacatggttgggatgagctcg
ttgagcggaggacgggaaaccataactctcagcaaaggggtgaagcagcttcttcaggcc
tgccatctggtggaagtccgagatcggagagttgaaattacgaaagaaggatttgccttt
gttctacaagacgtcaatacccaggtctggcatatactcatcctctatgtcgagaacgca
gaagctataggcatggaaagcgttgaggttctctcgttcattttcttgcttagtagcctt
gagctcggccagtcttatgagaaaaaggacctcactcccacacagcttcgaacacttgcc
gatctcactgattttggcatcgtctaccaacatacgcctgcttctgggtccacccgattc
taccctacccggctggctactacacttacgtctgactctttagctatgtcaggcccaata
tcaggagaacctgcggtcccgaccacaactgcaggtactacgacgtccggtgatgcaggc
accgggttcatcattgttgaaacaaactaccgtttatacgcatacacatcatcccctcta
cagatatctctcatatccctctttaccactctaaaattccgatttccgaatcttattacc
ggcaaaataacccgtcaatccgtccgccgagccatcgaaatgggtatcacggctgatcag
attatatcatatctcaccactcatgcccatccacagatgcgcaagacgaaaaaatctacg
tcaaacgtttcttcttcggtcttgccacctactgttgtcgaccaaatacggctttggcag
ctggaacgagatcgaatcaaagcaacatcagggtttcttttcaaggaattcgacaccttt
gcggaattcgaagctccttgcaagtatgctgaagaaatcggtgtcttggtttggaaatct
gattcaaggaggatgttttttgttaccagacatgaacaggttgctgcgttcctacgtagc
agagcggcgtcaaggggttaa

DBGET integrated database retrieval system