KEGG   Arthroderma benhamiae: ARB_04008Help
Entry
ARB_04008         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
abe  Arthroderma benhamiae
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:abe00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    ARB_04008
  Replication and repair
   03420 Nucleotide excision repair
    ARB_04008
Transcription machinery [BR:abe03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     ARB_04008
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 458 aa AA seqDB search
MLEDDIYRTSTQFRLWSFTEDSLRSIRANTNAVASERVRAAVRRAREARQQASAAPTPDQ
GTPNPNPNDADRAVTPARTGAGSEQEIECLTPDEEFELVQYFCEKTMELGDEYKPPLPTT
VRATAIQYLRRFYLTNSPMTYHPKSIMPCALFLATKTDNFYMSLRSFTEHIPNSTMESII
APEFLLTQGLRFTFDVRHPFRGLEGGMMELNAIAKGEATPGPHLLGLTPAGLQKSIQSLP
PPPTSIAGPVPASPLATRLAKVHHNTREILKHSAQMTDAYFLYTPSQIWISALLIADRPL
AEFYLETKLGPANTSPTSSTSPSDMLSNIHAKLIPVLQSCSDLLTSYIQNNGTSSTVPGS
ARMKRLKLIGKKLFHCQNPEREDLVALNRLQKAGGSAVPTGANTPSEPVAAPASVNVAAM
SEEQDVENDIDRAAKKRKLEGERLGGMDSPFGGELKRG
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgctagaagacgacatataccgaacctctacgcaatttcgcctctggtccttcacagaa
gactccctccgatcaatccgagctaatactaatgccgttgcaagcgagcgagttcgtgct
gccgtccgccgggccagagaagctcgacaacaagcctccgcagctccaacaccagaccaa
ggcacaccaaatccgaacccaaatgatgctgatagagccgttacgccagctcgaacagga
gcaggaagcgagcaggagatagaatgtcttacgccagatgaggagtttgagctggtacag
tacttttgcgagaagaccatggagttgggagacgaatataaaccgcctctgcctacaaca
gtaagggcgactgcgattcaataccttcgacgattctaccttacgaattccccaatgacc
taccacccgaaatctatcatgccgtgtgcgctcttcctagctacaaagacggataacttc
tacatgtccctccggtcatttacagaacacatacccaattcgacgatggaaagtataatt
gctcccgagttcctgctcacacagggcctacggtttacgtttgacgtacgccacccattc
cgtggattagagggcgggatgatggagttgaatgcgattgcaaagggagaagctacacca
ggaccccatcttctaggacttactccagctggacttcagaaatccatccagtcacttcca
cctccgcctacttcgatagctgggccagtacctgcttcgcctctagctacccgtttagca
aaagtacaccacaataccagagagatccttaagcactctgcacaaatgacagatgcatat
ttcctttataccccttcacagatatggatatctgcattactcattgccgatagaccacta
gctgagttctaccttgaaacaaagctgggcccggccaacacatcccctacttcctcaact
tcgccttcagacatgctctccaatatacacgccaaacttattcccgtcctacagtcctgc
agcgacctacttacctcttacatacaaaataatggaacatcaagcaccgttcccggctca
gcacggatgaagaggctcaagctgatagggaaaaagctatttcactgccagaacccggaa
agagaagatctcgttgcattgaacaggttgcagaaagcgggtggttcggctgtccccacc
ggagctaataccccttcagaaccagttgctgctccggcttcagttaacgtagctgctatg
agtgaggagcaagacgtggaaaatgatatagatcgcgccgctaaaaagcgcaaattggag
ggtgaaaggctcgggggaatggactctccgttcggaggggagctgaagaggggatga

DBGET integrated database retrieval system