KEGG   Arthroderma benhamiae: ARB_04132Help
Entry
ARB_04132         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
abe  Arthroderma benhamiae
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:abe00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 106 aa AA seqDB search
MGAVYEEKVKSFFDEHLHEDEEIRYILDGEGYFDVRSRDDKWVRIKVEKEDLLILPAGIY
HRFTTGESNYIKAMRLFQDEPKWTPLNREPALENNSFRQSYVAAHV
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcagtttacgaggaaaaagtgaaatcattcttcgatgagcaccttcatgaagat
gaggagattaggtacatcctggatggcgaaggatatttcgatgttcgcagcagagacgac
aagtgggtgcggattaaagttgagaaggaggacctgcttatcttgcctgccgggatatac
catcgcttcacgacgggagagagcaattatatcaaagcgatgaggttgttccaggatgaa
ccgaaatggacgcctttgaaccgcgaaccagcgcttgaaaacaattcgttcagacagagc
tatgttgctgcccatgtgtaa

DBGET integrated database retrieval system