KEGG   Arthroderma benhamiae: ARB_04150Help
Entry
ARB_04150         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
abe  Arthroderma benhamiae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 137 aa AA seqDB search
MIAIFDEDGGGDVDFQEFVSGLSAFSSKGNKEEKLRFAFKVYDIDRDGYISNGELFIVLK
MMVGSNLKDNQLQQIVDKTIMEADQDGDGKISFEEFTRMVENTDISMSMTLGMSIIPLPL
LSHLTRRSVILMLLSTN
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcaattttcgacgaagatggcggcggtgacgtagatttccaagaattcgtttcc
gggttatcggccttcagttcgaaaggtaacaaagaggagaagcttcgatttgcctttaaa
gtatatgatatcgaccgtgatgggtacatatcaaacggggagctgtttattgttttgaaa
atgatggttggcagcaacttgaaggacaaccagctccagcagatagtggataagaccatt
atggaagccgatcaggatggtgatgggaaaataagctttgaagagtttacaaggatggtt
gagaacaccgacatcagcatgagtatgactttgggtatgtctataattccccttcctctc
ctttctcacctcactcggagaagcgttattctaatgctattatcaactaactaa

DBGET integrated database retrieval system