KEGG   Arthroderma benhamiae: ARB_04255Help
Entry
ARB_04255         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
abe  Arthroderma benhamiae
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    ARB_04255
Enzymes [BR:abe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     ARB_04255
Glycosyltransferases [BR:abe01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   ARB_04255
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 744 aa AA seqDB search
MAADDRAFASGTSPNTEVRRRNVPGAEKSSANVPIPSIEVDGKKLKEKSPSFCEILDDLE
VFIAPLIFTALACFTRLWRIGLSDIVTWDEAHFGKFGSYYIKREFYFDVHPPLGKMLIGL
SGFLAGYNGSFEFKSGEKYPPEVNYTFMRIFNAFFGIVCIPLAYYTARELKFRRPTVWLI
TLMVLCENSYATISRFILLDSMLLCFTFTTTLCWARFHRLRHESFSPEWYLWLILTGLSI
GCVCSVKWVGIFCTALVGLYTAEDLWNKFGDLKMPKTVLAHHLGARVFGLIIVPFLVYMF
SFYIHFLVLENSGTGDAQMSSLFQANLRGTNVGKDSPLEVAIGSKITLKNMGYGGGLLHS
HVQTYPEGSGQQQITCYHHKDSNNDWFIYPNRSQPDYNPEGPISFIGDGDVIRLIHAQTG
RNLHSHTVAAPVTKAQYEVSAYGNTTVGDAKDHWTIEVVKDVASRDRSKIRTLTTALRLR
HTVLGCYLRAGGVSLPQWGFKQIETTCTKENRPWDVYTHWNIESHVNERLPPSEPGTYKS
PFLKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPILNVGLRMCSWDDNVVKYFLLG
NPFVYWGSTLSLGVFSLLVLWYLLRWQRGYAELSMAEIDHIHYSGIYPVVGWFLHYLPFM
IMARVTYVHHYYPALYFAILTMAFCIDWFTQKLNRKVEWAIYSVLYVIIIGLFIVFKDIV
FGMEGSNQQWKSLNWLSSWKIANR
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgatgatagagcgtttgcttctggcacctcgccgaacacagaagttcggagg
agaaacgtgcctggtgcagagaagagcagcgccaatgtcccaattcccagcattgaagtc
gacgggaagaaactgaaggagaagtccccctccttctgtgagattctcgatgacctagaa
gtgttcattgccccattgatcttcactgctctggcttgcttcactcgtttgtggcgcatt
ggtctctcagatatcgttacgtgggatgaagctcatttcgggaaatttggttcatactac
atcaaacgagaattctatttcgatgtccaccctccgctgggtaaaatgcttattggattg
tcgggtttcctggctggttataacggatctttcgaattcaagtctggcgagaaataccct
ccggaagttaactacaccttcatgcgtatcttcaatgctttcttcggtatcgtatgcatt
ccacttgcatactatactgcgcgagaactgaaattccgccgtccaaccgtctggcttatc
accctgatggtgctttgcgagaattcctacgccacgatttccagatttattcttttggat
tctatgcttctctgcttcaccttcaccactaccctctgctgggcaagattccaccgactt
cgacatgaaagcttctcccccgagtggtatctctggctcatcctcactggcctgagcatt
gggtgtgtctgcagtgtaaaatgggtcggaatcttctgcactgcactagttggtctttac
accgctgaggatctttggaacaagtttggagacctaaagatgccaaagacggttcttgct
catcacttgggagcccgtgttttcggtctgataatcgtaccattcttggtctatatgttc
tccttctacattcatttccttgtacttgagaactctggtaccggtgacgctcagatgagc
tctttgttccaagctaacttgagaggtaccaacgttggcaaggacagccctcttgaggtc
gccattggatccaaaatcacactgaagaatatgggatacggaggtggtctactacactct
cacgttcagacttatcccgaaggatcgggtcagcaacagatcacttgctaccaccataag
gactctaacaacgactggttcatctatccgaaccgttctcagccggattataatccagaa
ggtccaattagctttattggtgatggtgacgtgatccgccttatccacgctcagaccggc
cgcaacttgcactctcacaccgtggcagccccagtcaccaaggctcaatatgaagtgtct
gcctatggaaacaccaccgttggtgatgccaaggaccactggaccatcgaggttgtcaaa
gacgttgcgtcgagagacaggtcgaaaatcagaactcttaccactgccctccgcctgcgc
catacggtcttaggttgttatcttagagctggcggtgtcagcttgcctcagtggggattc
aagcagattgagactacctgcaccaaggagaaccgaccatgggacgtgtatactcactgg
aacatcgagtcacacgtgaatgagaggcttcctccaagtgaaccaggcacttacaagtcg
cccttcctcaaggactttatccacctgaatgttgctatgatgacttccaataacgctctt
gtcccagatcccgataagcaagatgacctagcatcgaagttctggcaatggccaatcctt
aatgttggactccgaatgtgctcctgggacgacaatgtcgttaagtacttcctccttgga
aacccattcgtctactggggcagtaccctgagtttgggtgttttcagtctactcgtcctc
tggtatctgcttcgctggcagcgcggctatgccgaactcagcatggccgagatcgaccac
atccactattccggcatttaccccgttgtgggctggttcctccactatctccccttcatg
attatggcccgtgtcacctatgtccatcactactacccggccttgtactttgctatcttg
accatggctttctgtattgactggttcactcagaagcttaaccggaaggtcgagtgggcc
atttattcagtcctctatgtcattattattggcctatttatcgtcttcaaggacatcgtt
ttcggtatggaaggctcaaaccagcagtggaagagtctcaattggttaagcagttggaag
attgccaaccgatag

DBGET integrated database retrieval system