KEGG   Arthroderma benhamiae: ARB_04392Help
Entry
ARB_04392         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K11427  
histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
abe  Arthroderma benhamiae
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    ARB_04392
Enzymes [BR:abe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     ARB_04392
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 522 aa AA seqDB search
MGFFDHLQKKGTGVIQAQKAQIRRVECKPPIVRSSSAPSHPVKPPSERAHSESSAKRIVT
SPRKSTLSDSTGTVKKKVAVASKSDHLAVNPPRSRSVSRKRSSPAVQQLLSSSDGSETDE
SLDIRLSKRTKVSASAEPDLKRQLRSEIAFSETAEHSFPMVHAMDIASIEKKTPGFSSAF
KEPSGCTTIALQYPTYSQRERYQLVIPRENDGFKPLEDIVQVVETVSHNYIPEDQISAFT
DDSTGYIRLLRRAIKQESPKDFWNAVKAYNETIRRLRDEGVIAKHLDAMHSLSLPWVERI
LTQVYSRTVSLRVESLKKYESGTDNVYGELLPRFISDIFQKTHLKSDQVFVDLGSGVGNV
VLQAALEVGCESWGCEMMQNACDLARLQQAEFKARCRLWGLSSGKVHLVQGDFLDNERIA
KALRRADVVLINNQAFTPETNNRIINLLLDLKEGCQIVSLKSFVPTGHKMQARNLNSPIN
LLSVERHNYWSDSVSWTNAGGTYFIAKKDSSRLRAFSDSLYN
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgggttttttcgaccaccttcagaagaaagggacaggtgtgatacaggcccaaaaggct
cagatacgcagagtcgaatgcaagccgcccatcgtccggtcttcatcggccccatcacac
cccgtgaaacccccctccgagcgcgcgcactccgaatcatccgccaaacgtatcgtcacc
tctccacggaaatcgaccttatccgactctaccggaactgtgaagaagaaggttgctgtt
gctagcaagtccgatcatctggccgttaacccgccccgttcaagatccgtgtcccgcaag
cgatcgtcccccgcagtccaacaactccttagcagtagcgatggcagcgagaccgacgag
tctctggatatccggttatcgaaaaggaccaaggtgagcgctagcgcggagccagattta
aaacgccagttacgctccgagattgcgttttctgagactgccgaacactcattcccgatg
gtccatgccatggacatagcatccatcgagaagaagacgccgggattcagcagtgctttt
aaagagcccagcgggtgcacaacaatagctcttcagtatcccacatactcgcagagggag
aggtaccagctggtcataccgcgagaaaacgatgggttcaagccgttggaagatattgtg
caggtggtcgaaactgtatcacacaactatatccccgaggaccagatatctgctttcacc
gatgactccaccggctatatccgtcttttgcggcgtgccatcaaacaggaatcgccaaag
gacttttggaatgcggtgaaggcgtataatgaaaccatcagacggctccgggacgaaggc
gttattgccaaacaccttgatgcgatgcattcactctcgctgccgtgggttgagagaatt
ctaacccaggtgtatagccgaactgtctctctgcgtgtggaatcactcaagaagtacgaa
agcggaactgataacgtctatggagagcttctaccccgctttatctcagatatattccaa
aagacgcatttaaaatctgaccaggtattcgttgatctgggttccggtgtgggcaacgtt
gtcctccaggccgccctggaggttggttgtgagagctggggttgtgagatgatgcaaaat
gcctgcgacttggctcgtctgcagcaggctgaattcaaagctagatgccgtttatggggc
ctgtcatcgggaaaagtacatttagtccagggtgacttcttggacaacgaacgcatagct
aaggctctacggcgggctgacgtcgttctcatcaataatcaggctttcaccccggaaacg
aacaacaggataatcaatcttttgctggacctgaaagaaggctgccagattgtatcactc
aaatcctttgttccgacaggacacaagatgcaagcccgaaacctcaactcacctattaac
ctgctttcagttgagagacataattattggtctgactctgttagctggaccaatgctggg
ggcacctatttcattgcaaaaaaggatagctccagactgcgagccttttcagactctctt
tataactga

DBGET integrated database retrieval system