KEGG   Arthroderma benhamiae: ARB_04515Help
Entry
ARB_04515         CDS       T01611                                 

Definition
endosome-associated ubiquitin isopeptidase (AmsH), putative
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
abe  Arthroderma benhamiae
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:abe00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    ARB_04515
Enzymes [BR:abe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     ARB_04515
Peptidases [BR:abe01002]
 Metallo Peptidases
  Family M67
   ARB_04515
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 588 aa AA seqDB search
MLPPLTVEQIARQAGQYEFDPQVPLRYWLRSAGLLVKEARIYEQEGNDQQAYLLLFRHAQ
LVLINLTAHPDARDPKNKQGLAAAKKEVQASLNKLEILKPRIRRLYDRYQELQQRSQAEN
HAAATTTASTMEDHTATTFSDLDATIQSATTVQDPALAGRPEALQAAENRDFAVRLAQSE
FRRRAFARGDARRPSYASSEASVSTANTANTTNTAKMEGDVLARRLQEVRSMLSSGLSKS
NTVSSSSPTSRSPTLMPIEQHLSGYRYPSIPRQSYQHHHTSSHSPIRPPKIEQAPPVPGK
TPAIPAKIPDSDITSSSSSSTAALTTSLLPPLPSKVPPLPPRAGSVTPSPSHTPTHSRSN
TRTLLSSPPKLPSKQPPTPDTEKDILHPSTFTFKPSSYLENGTPLRTIFISPDLRTQFLS
LAAPNTAANLETCGILAGTLISNAFFISRLIIPEQESTPDTCEMLNEAAIFEYCEAEDLM
VLGWIHTHPTQTCFMSSRDLHTQSGYQVMLSESIAIVCAPSHEPSWGVFRLTDPPGLKSV
LNCTRPGLFHPHDETNIYTDALRPGHVFEAKGLDFETVDLRPSTSSQK
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgctgccgcctttgaccgtcgagcagatagctcggcaggccggccagtacgagttcgat
ccccaggtgcctcttcgctactggcttcgctccgccggcttgcttgtcaaagaggctcga
atatacgaacaagagggcaacgaccagcaggcctacctccttctcttcagacacgcccag
ctcgtcctcatcaacctcactgcccaccccgacgcccgagacccaaagaacaaacaaggg
ctcgccgccgcaaagaaggaagtccaggcttcactcaacaagctggagatactcaaaccc
cggatccgcaggctatacgaccgataccaggagctccagcagcgcagtcaggctgagaac
catgctgcggccactaccactgcatctacaatggaggatcacaccgcaaccaccttctcc
gatctagatgctaccattcaaagcgcaaccacagtgcaagacccagcgctggcaggccga
ccagaggcactgcaggctgctgaaaacagagactttgccgtcagactggcccagagcgaa
ttcaggcgcagagcctttgcgcgtggagatgccaggcggccgtcatatgccagctccgag
gccagtgttagtaccgccaacaccgccaacactaccaatactgccaagatggaaggagat
gtgctcgcaaggaggctacaggaggtcagatccatgctcagcagcggcctatcaaagtct
aatactgtttcttcttcctctcctacctcgagatcgcccactctcatgcctatagagcag
catctctccggatacagatacccttctatcccaagacagagctatcaacaccatcatacc
agttcccactctcctatccgtcccccaaagatcgaacaggcaccaccagtcccaggaaag
acaccagccatacccgctaagatacccgactctgacatcacctcctcctcctcctcctcc
accgctgcattaactacttctcttcttcccccactaccaagcaaagtaccccccttacct
cccagggcaggctcagtaactccttcgccctcacacacccctactcactcacgctccaac
acccgcacccttctctcttctcctccaaagctaccatccaaacaacctcccaccccagac
acagagaaggacatcctccacccctcaacattcaccttcaaaccatcctcctacctcgaa
aatggtactcctctccgcacaatcttcatctctcctgatctacgtacccaattcctctcc
ctcgccgcccccaacactgccgctaacctagagacatgcggcatcctagcgggcaccctc
atatcaaacgcattttttatttcgcggcttatcatcccagagcaagaatctaccccagat
acatgcgaaatgctcaatgaggctgctatattcgagtactgcgaggcagaagatctcatg
gttctaggctggatccacactcacccgacacaaacttgtttcatgagttcaagagacctg
catacccagtccggctatcaagtaatgctgtcagaaagtattgccattgtctgtgcaccc
agccacgagccgagctggggtgtttttcgattgacggaccccccgggcctgaagtcagtg
ttgaactgtactcggcctggcttgttccacccccacgacgagacaaatatatataccgac
gccctgcggccaggacatgtgtttgaagcgaaaggtctagattttgagactgttgactta
cgaccatcgacatcgtcacagaaatga

DBGET integrated database retrieval system