KEGG   Arthroderma benhamiae: ARB_04572Help
Entry
ARB_04572         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K00601  
phosphoribosylglycinamide formyltransferase [EC:2.1.2.2]
Organism
abe  Arthroderma benhamiae
Pathway
Purine metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:abe00230]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:abe00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 216 aa AA seqDB search
MDSPTRLTILISGSGTNLQAVIDAIDAKTLPATVVRVLSNRKDAYGLERAKKAGIPTVYH
NLLTYKKKHPNTEEGVKKAREEYDTELARIVLDDKPDLVVCLGFMYVLSKKFLDPMAKAG
LDTINLHPALPGAFNGTHAIERAQEAWLEGKIDKTGVMIHKVIAEVDMGEPILTREIPFI
KGVDEDLEALKERIHKIEWEVVIEGINIMIKRMEER
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggattcccctacgcgcctcacaatcctcatctccgggagcggcaccaacctccaagcc
gtgatcgatgccattgacgccaaaactctccccgcaacagtcgtgcgagtcctgtcgaac
cggaaagacgcatatggcctcgagagggcaaagaaagccggcatacctaccgtataccat
aacctactaacatacaagaaaaaacacccaaacacggaagagggtgtcaagaaagctcgg
gaggaatatgacaccgagttggcacggatagtactggacgataagcctgaccttgttgtc
tgtctagggtttatgtatgtgctatcaaagaagttcctggatccaatggcaaaggcaggc
ctggatactataaatctgcaccccgcgctaccgggcgcattcaacggaactcatgccatt
gaacgcgcccaagaagcatggctagaaggcaaaattgataagacaggagtcatgatccat
aaagtcattgcagaggttgatatgggcgaaccaatcctgacacgcgagatcccatttata
aaaggtgtggatgaagatctggaggcactcaaggagagaatacacaagatcgagtgggaa
gtggtgatagaaggaataaatatcatgataaaaaggatggaggagaggtag

DBGET integrated database retrieval system