KEGG   Arthroderma benhamiae: ARB_04804Help
Entry
ARB_04804         CDS       T01611                                 

Definition
tryptophan synthase
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
abe  Arthroderma benhamiae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:abe01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:abe00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:abe00400]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 693 aa AA seqDB search
MEQIKETFRRCKEEKRSALVAYVTAGYPEASETVDIILAMEDGGADIIELGVPFTDPIAD
GPTIQRANTQALKNGVTVTSVLEMVRTARRKGLKAPVMMMGYYNPLLQYGEERMLKDAKA
AGVNGFIMVDLPPEEAVRFRDLCKKEGLSYVPLIAPATSEARMKLLCGIADSFIYVVSRM
GVTGATGTLSSGLPELLKRVHTYSGNVPAALGFGVSTREHFLEVQGIAEGVVIGSQMVTV
LGDAAPGERAQKIREYCSSITGRTVQRGPIPEVADEPGLADQLEALNTTKNPAAIPAQFG
EFGGQFVPESLMDCLAELEAGFNEAKNDPKFWEEYRSYYPYMSRPSSLHLAERLTEHAGG
ANIYLKREDLNHTGSHKINNALGQVLLARRLGKKRIIAETGAGQHGVATATVCAKFGMEC
VIYMGAEDVRRQALNVFRIKLLGASVIPVEAGSRTLRDAVNEALRAWVVHLDTTHYVIGS
AIGAHPFPTIVRTFQSVIGEETKAQMKELTGRLPDAVVACVGGGSNAVGMFYPFSNDPSV
KLLGVEAGGDGVDTARHSATLTGGSKGVLHGVRTYVLQNEHGQISDTHSISAGLDYPGVG
PELSNWKDSARAKFIAATDAQALIGFKTISQLEGIIPALESSHAVYGAIELAKTMKKGEN
IVLNLSGRGDKDVQSVADALPELGPKIGWDLRF
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atggagcaaataaaggagacatttcggcgatgcaaggaggagaaaagatctgctctcgtg
gcgtatgtcacagcggggtaccctgaggccagcgagacggtcgatatcatccttgccatg
gaagatggaggtgcagacattatcgaacttggagtcccattcacagacccgattgccgat
ggtcctaccatccagcgcgcaaacactcaggcgcttaagaatggagtcaccgttacttct
gttcttgagatggttagaactgctaggaggaagggactcaaggcccctgtgatgatgatg
ggatactacaaccccttgctacagtatggtgaagagagaatgttgaaggatgccaaagcc
gcaggagtcaacggctttatcatggttgacttgccgccagaagaagccgttcggttcaga
gatttgtgcaaaaaagaagggctctcttatgtcccgctgattgcgccggctacttccgag
gcccgtatgaaacttctctgcggaattgccgactccttcatctatgtcgtctctagaatg
ggtgttactggtgctaccggaacattgagctctggattacccgaacttttgaagcgagtg
cacacatattccggaaacgtccctgctgcgctgggattcggcgttagcaccagggagcac
ttcctagaagtccagggtatcgctgagggtgttgttatcggtagtcagatggtgactgtc
ctaggcgacgctgctccaggagagcgtgcccagaagatccgcgaatactgttcgagcatc
acaggtcgaactgtccaacgcgggcctatccccgaggtagccgacgagccaggccttgca
gaccagctcgaggctcttaacaccaccaagaaccctgcagctatccctgcacaattcggc
gaatttggaggccagtttgttcccgagtcattgatggattgcctcgctgagctggaggct
ggattcaacgaggccaagaatgaccccaaattctgggaagagtaccgctcttactaccca
tatatgagccgtccaagtagtcttcatcttgccgagcgcctgactgaacatgctggtgga
gctaacatctatctcaagcgagaagatcttaaccacaccggcagtcacaaaatcaacaac
gccctaggccaagtccttcttgcccgtcgccttggaaagaagagaattattgctgaaact
ggtgccggtcagcatggtgtcgctaccgccactgtctgcgccaaattcggcatggagtgt
gtcatttacatgggagcagaggatgttcgtcgccaagctctgaatgtattcagaataaaa
ctccttggagcctccgttatccccgttgaggctggatcacgtaccctccgtgatgcggtc
aacgaagctttgcgcgcttgggttgtccatctcgacacaacgcactatgttatcggctca
gccatcggagctcatcctttcccaaccatcgtccgaactttccagtcagttatcggagaa
gaaaccaaagcccagatgaaagaactcactggccgcctgccagatgctgtcgttgcttgt
gttggcggtggaagcaatgcagtgggcatgttctaccccttttccaatgatcccagcgtc
aaactccttggcgtagaagccggtggtgacggagtcgacaccgcgcgtcactcagctacc
cttacagggggctcgaagggcgtgctccacggcgtccgaacatatgtccttcaaaacgaa
cacggccagatctcagacacccactccatttctgctggattggattaccccggtgttgga
ccggagttgagtaactggaaggattccgccagggctaagttcatcgctgccactgacgca
caggctttaattggattcaagaccatttcgcagctggagggtatcattccagcccttgag
tcttcgcatgctgtttacggcgcaattgagctggctaagacaatgaagaagggtgagaac
atcgtgctcaatttgagtggacgaggcgacaaggatgtgcagagtgttgctgatgctctt
cctgaacttggacccaaaattggctgggatttgagattctaa

DBGET integrated database retrieval system