KEGG   Arthroderma benhamiae: ARB_04804Help
Entry
ARB_04804         CDS       T01611                                 

Definition
(RefSeq) tryptophan synthase
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
abe  Arthroderma benhamiae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ARB_04804
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ARB_04804
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ARB_04804
Enzymes [BR:abe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ARB_04804
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 693 aa AA seqDB search
MEQIKETFRRCKEEKRSALVAYVTAGYPEASETVDIILAMEDGGADIIELGVPFTDPIAD
GPTIQRANTQALKNGVTVTSVLEMVRTARRKGLKAPVMMMGYYNPLLQYGEERMLKDAKA
AGVNGFIMVDLPPEEAVRFRDLCKKEGLSYVPLIAPATSEARMKLLCGIADSFIYVVSRM
GVTGATGTLSSGLPELLKRVHTYSGNVPAALGFGVSTREHFLEVQGIAEGVVIGSQMVTV
LGDAAPGERAQKIREYCSSITGRTVQRGPIPEVADEPGLADQLEALNTTKNPAAIPAQFG
EFGGQFVPESLMDCLAELEAGFNEAKNDPKFWEEYRSYYPYMSRPSSLHLAERLTEHAGG
ANIYLKREDLNHTGSHKINNALGQVLLARRLGKKRIIAETGAGQHGVATATVCAKFGMEC
VIYMGAEDVRRQALNVFRIKLLGASVIPVEAGSRTLRDAVNEALRAWVVHLDTTHYVIGS
AIGAHPFPTIVRTFQSVIGEETKAQMKELTGRLPDAVVACVGGGSNAVGMFYPFSNDPSV
KLLGVEAGGDGVDTARHSATLTGGSKGVLHGVRTYVLQNEHGQISDTHSISAGLDYPGVG
PELSNWKDSARAKFIAATDAQALIGFKTISQLEGIIPALESSHAVYGAIELAKTMKKGEN
IVLNLSGRGDKDVQSVADALPELGPKIGWDLRF
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atggagcaaataaaggagacatttcggcgatgcaaggaggagaaaagatctgctctcgtg
gcgtatgtcacagcggggtaccctgaggccagcgagacggtcgatatcatccttgccatg
gaagatggaggtgcagacattatcgaacttggagtcccattcacagacccgattgccgat
ggtcctaccatccagcgcgcaaacactcaggcgcttaagaatggagtcaccgttacttct
gttcttgagatggttagaactgctaggaggaagggactcaaggcccctgtgatgatgatg
ggatactacaaccccttgctacagtatggtgaagagagaatgttgaaggatgccaaagcc
gcaggagtcaacggctttatcatggttgacttgccgccagaagaagccgttcggttcaga
gatttgtgcaaaaaagaagggctctcttatgtcccgctgattgcgccggctacttccgag
gcccgtatgaaacttctctgcggaattgccgactccttcatctatgtcgtctctagaatg
ggtgttactggtgctaccggaacattgagctctggattacccgaacttttgaagcgagtg
cacacatattccggaaacgtccctgctgcgctgggattcggcgttagcaccagggagcac
ttcctagaagtccagggtatcgctgagggtgttgttatcggtagtcagatggtgactgtc
ctaggcgacgctgctccaggagagcgtgcccagaagatccgcgaatactgttcgagcatc
acaggtcgaactgtccaacgcgggcctatccccgaggtagccgacgagccaggccttgca
gaccagctcgaggctcttaacaccaccaagaaccctgcagctatccctgcacaattcggc
gaatttggaggccagtttgttcccgagtcattgatggattgcctcgctgagctggaggct
ggattcaacgaggccaagaatgaccccaaattctgggaagagtaccgctcttactaccca
tatatgagccgtccaagtagtcttcatcttgccgagcgcctgactgaacatgctggtgga
gctaacatctatctcaagcgagaagatcttaaccacaccggcagtcacaaaatcaacaac
gccctaggccaagtccttcttgcccgtcgccttggaaagaagagaattattgctgaaact
ggtgccggtcagcatggtgtcgctaccgccactgtctgcgccaaattcggcatggagtgt
gtcatttacatgggagcagaggatgttcgtcgccaagctctgaatgtattcagaataaaa
ctccttggagcctccgttatccccgttgaggctggatcacgtaccctccgtgatgcggtc
aacgaagctttgcgcgcttgggttgtccatctcgacacaacgcactatgttatcggctca
gccatcggagctcatcctttcccaaccatcgtccgaactttccagtcagttatcggagaa
gaaaccaaagcccagatgaaagaactcactggccgcctgccagatgctgtcgttgcttgt
gttggcggtggaagcaatgcagtgggcatgttctaccccttttccaatgatcccagcgtc
aaactccttggcgtagaagccggtggtgacggagtcgacaccgcgcgtcactcagctacc
cttacagggggctcgaagggcgtgctccacggcgtccgaacatatgtccttcaaaacgaa
cacggccagatctcagacacccactccatttctgctggattggattaccccggtgttgga
ccggagttgagtaactggaaggattccgccagggctaagttcatcgctgccactgacgca
caggctttaattggattcaagaccatttcgcagctggagggtatcattccagcccttgag
tcttcgcatgctgtttacggcgcaattgagctggctaagacaatgaagaagggtgagaac
atcgtgctcaatttgagtggacgaggcgacaaggatgtgcagagtgttgctgatgctctt
cctgaacttggacccaaaattggctgggatttgagattctaa

DBGET integrated database retrieval system