KEGG   Arthroderma benhamiae: ARB_04828Help
Entry
ARB_04828         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
abe  Arthroderma benhamiae
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    ARB_04828
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 148 aa AA seqDB search
MCATCSIWALSVIDSLVEDEKRREQQKPQELLKEMDKANKPARLPGDASKGAGLFKTRCA
SCHTLEDGGANKVGPNLYGLFGRKSGQVEGFSYTDANKQKGVTWDENTLFEYLENPKKYI
PGTKMAFGGLKKAKDRNDLITFLKENTK
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgcaacatgctctatctgggcgctgtcagttattgatagccttgttgaagatgaa
aagcgcagagagcagcagaaaccacaggagcttttgaaagagatggataaagctaacaaa
cctgcccgtcttccaggtgatgcctccaagggtgctggtctcttcaagacccgctgtgct
tcctgccacaccctagaagatggcggcgccaacaaggtcggccccaacctttatggcctc
ttcgggcgcaagtccggccaggtcgagggtttctcctacaccgacgccaacaagcagaaa
ggtgtcacctgggacgaaaatactctcttcgagtacctcgagaacccaaagaagtacatc
cccggtaccaagatggcctttggtggtctcaagaaggccaaggaccgcaacgacctcatc
accttcctcaaagagaacaccaaataa

DBGET integrated database retrieval system