KEGG   Trichophyton benhamiae: ARB_04828Help
Entry
ARB_04828         CDS       T01611                                 

Definition
(RefSeq) hypothetical protein
  KO
K08738  cytochrome c
Organism
abe  Trichophyton benhamiae
Pathway
abe01100  Metabolic pathways
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 CCP_MauG BPS1 Cytochrom_C550 Subtilosin_A
Motif
Other DBs
NCBI-GeneID: 9522021
NCBI-ProteinID: XP_003016539
UniProt: D4AKI5
AA seq 148 aa AA seqDB search
MCATCSIWALSVIDSLVEDEKRREQQKPQELLKEMDKANKPARLPGDASKGAGLFKTRCA
SCHTLEDGGANKVGPNLYGLFGRKSGQVEGFSYTDANKQKGVTWDENTLFEYLENPKKYI
PGTKMAFGGLKKAKDRNDLITFLKENTK
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgcaacatgctctatctgggcgctgtcagttattgatagccttgttgaagatgaa
aagcgcagagagcagcagaaaccacaggagcttttgaaagagatggataaagctaacaaa
cctgcccgtcttccaggtgatgcctccaagggtgctggtctcttcaagacccgctgtgct
tcctgccacaccctagaagatggcggcgccaacaaggtcggccccaacctttatggcctc
ttcgggcgcaagtccggccaggtcgagggtttctcctacaccgacgccaacaagcagaaa
ggtgtcacctgggacgaaaatactctcttcgagtacctcgagaacccaaagaagtacatc
cccggtaccaagatggcctttggtggtctcaagaaggccaaggaccgcaacgacctcatc
accttcctcaaagagaacaccaaataa

DBGET integrated database retrieval system