KEGG   Arthroderma benhamiae: ARB_04887Help
Entry
ARB_04887         CDS       T01611                                 

Definition
dihydrofolate reductase, putative
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
abe  Arthroderma benhamiae
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ARB_04887
   00670 One carbon pool by folate
    ARB_04887
Enzymes [BR:abe01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     ARB_04887
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 284 aa AA seqDB search
MPAKLPPLTLVVATTPITTPTNPGILKLGIGKGGTLPWPRIKKDMSFFARVTTRPPATAT
ASGTASPAINAVIMGRKTYDSIPAKFRPLSKRLNVIITRDESGSVKERAIADWNASRKRE
LEKQADQDTGEAATTSTSTEEPEVIVSSSLEDALSKLQRNFVTSSSSDVQEGKRRLGNVY
IMGGSEIYASSLRLTADTLGEHNPLRIVMTDIRRRVEGNPQCDVEELVDGFECDTCFPLD
GKDLKEGWNKVPSEKLTEWVGEAVSSDWAWEGDVAMKISGYEKL
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcaaaactcccacccctcactctcgtcgtcgcgaccacacccataacaactcct
acaaatcccggcattcttaaactcggaattggcaaaggaggcacattgccatggcccaga
ataaagaaagatatgagcttttttgctcgcgtaacgacgcgccctccagccacagccaca
gcctctggaacagcttcaccagctatcaacgccgtgatcatgggccgaaagacatatgac
tcgataccagcgaaatttcgaccactatccaagagacttaacgtcattataacccgagac
gaatctgggtcagtcaaggagcgagcaattgcagactggaatgcgtcgaggaaacgggag
ttagagaagcaggcagaccaggatactggcgaggctgcaactacatctacgtctactgag
gaaccagaggtcatagtctcgagcagtttggaggatgcgttatctaagttgcagagaaat
ttcgtgacaagctcgtcatcggatgtacaggaggggaagaggcggttgggcaacgtatat
atcatgggagggagtgagatatacgcttctagcctgcgcctgaccgcagacactctcgga
gagcacaacccgcttcgaatagttatgactgatattcgaaggcgtgtggaagggaaccca
cagtgtgacgttgaggaactagttgatgggtttgagtgtgatacctgtttccccttagat
ggaaaggatttgaaagaagggtggaacaaagttccatctgagaaacttacagaatgggtt
ggtgaagctgtatcttctgattgggcttgggaaggtgatgttgccatgaagatctcggga
tatgaaaagttatga

DBGET integrated database retrieval system