KEGG   Arthroderma benhamiae: ARB_04887Help
Entry
ARB_04887         CDS       T01611                                 

Definition
dihydrofolate reductase, putative
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
abe  Arthroderma benhamiae
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:abe00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:abe00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 284 aa AA seqDB search
MPAKLPPLTLVVATTPITTPTNPGILKLGIGKGGTLPWPRIKKDMSFFARVTTRPPATAT
ASGTASPAINAVIMGRKTYDSIPAKFRPLSKRLNVIITRDESGSVKERAIADWNASRKRE
LEKQADQDTGEAATTSTSTEEPEVIVSSSLEDALSKLQRNFVTSSSSDVQEGKRRLGNVY
IMGGSEIYASSLRLTADTLGEHNPLRIVMTDIRRRVEGNPQCDVEELVDGFECDTCFPLD
GKDLKEGWNKVPSEKLTEWVGEAVSSDWAWEGDVAMKISGYEKL
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcaaaactcccacccctcactctcgtcgtcgcgaccacacccataacaactcct
acaaatcccggcattcttaaactcggaattggcaaaggaggcacattgccatggcccaga
ataaagaaagatatgagcttttttgctcgcgtaacgacgcgccctccagccacagccaca
gcctctggaacagcttcaccagctatcaacgccgtgatcatgggccgaaagacatatgac
tcgataccagcgaaatttcgaccactatccaagagacttaacgtcattataacccgagac
gaatctgggtcagtcaaggagcgagcaattgcagactggaatgcgtcgaggaaacgggag
ttagagaagcaggcagaccaggatactggcgaggctgcaactacatctacgtctactgag
gaaccagaggtcatagtctcgagcagtttggaggatgcgttatctaagttgcagagaaat
ttcgtgacaagctcgtcatcggatgtacaggaggggaagaggcggttgggcaacgtatat
atcatgggagggagtgagatatacgcttctagcctgcgcctgaccgcagacactctcgga
gagcacaacccgcttcgaatagttatgactgatattcgaaggcgtgtggaagggaaccca
cagtgtgacgttgaggaactagttgatgggtttgagtgtgatacctgtttccccttagat
ggaaaggatttgaaagaagggtggaacaaagttccatctgagaaacttacagaatgggtt
ggtgaagctgtatcttctgattgggcttgggaaggtgatgttgccatgaagatctcggga
tatgaaaagttatga

DBGET integrated database retrieval system