KEGG   Arthroderma benhamiae: ARB_04926Help
Entry
ARB_04926         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
abe  Arthroderma benhamiae
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:abe00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    ARB_04926
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    ARB_04926
   04113 Meiosis - yeast
    ARB_04926
Protein phosphatases and associated proteins [BR:abe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     ARB_04926
Ubiquitin system [BR:abe04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     ARB_04926
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 805 aa AA seqDB search
MAPSGPHIASQLRQLIYYHLDNNLLRNALFLAGRLHAFEPRSSEAAYLLSHCLLQSGQPK
YAWEVCRNAGSRGTHLGCAYVYAQACLDLGNYMEGITALERSKPQWTSKNNWSGTDKHSE
NRRQHLPDAAAVLCLQGKLWHAHKDIHKAVDCYVEALKLNPFLWDAFLGLSETGANVRVP
NIYKMTPEMVAMLTPSASESSFSEKSIANSQPLQAQPSANHNVDPFSSTNGTSYGSSALW
EKLNGSSVSVASAVLPEGLETPITQSDSDDFRVRTGPNTGDTYGEPPFAPARKSRTMQVL
GVESCVDPPRLKSNSTRSRSKPKSASAEEPVSSKETTSSQQNASAMERKRTVSGHIAPTN
TAQQPVEPGAPQRRSVRLFNQIRPTSKFSTSAASLGTREGREIKKAKSTSSKSRSTATAA
PLGRSTTSSRKHGVESTETDSKESRSNGTSSESLNGPSRPQVPDKSKEIDALAWTLDLFS
RLASGHAALCSYRCQDALQIYNSLPQNQRETPWVLSQIGRAYYEQALYSDAEKYFSRVRT
IAPSQLEGMEVYSTVLWHLKNEVELAYLAHELMDTDRLAPESWCAIGNSFSLQSDHDQAL
KCFRRATQVDPAFAYGYTLQGHEYMSNEEYDKAQDAYRAAIKANPRHYSAWYGLGKVYER
MGKLRFAEQHLRTASNINPANVVLICSIGLVLERQNNLKAALLQYSRASSLSPHSVLARL
RKARTLLKLNEVNLAHVELKVLKDVAPDEPNVHYLLGKLYKMIQDKGNAIKHFTTALNLD
PKAAQFIKEAMESLENPDDVDDDMT
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atggctccctcggggccgcatatcgccagccagctacggcagctgatatactaccatctc
gataataacctgcttcgaaacgccctgttcctggccggccggctgcatgcgttcgagccc
aggtcgtcggaggccgcctacctgctctcgcactgtctgctgcagtccggacagccaaag
tacgcctgggaggtctgtcggaatgccggatcgcgaggcacacatcttggatgtgcctat
gtctatgctcaggcatgtcttgacctcggaaactatatggagggaatcactgccttggag
cgaagcaaacctcagtggacatcgaagaataactggagtggaacagataaacatagtgaa
aacagacgacaacatcttcctgacgcagctgcggttctttgtctccagggcaagctatgg
catgcacacaaagacatacataaagctgtcgactgctatgtcgaagctctcaaactgaac
cctttcctgtgggatgctttccttgggctttctgaaacaggtgcaaatgtgagggtgccg
aatatctacaagatgacaccagaaatggtggcaatgctcactccatcagcctcggagagc
tcgttctctgagaaatctatcgccaatagccagccactacaagcacagcccagtgctaat
cacaatgttgatcccttttcgtcgacgaacgggactagctacggcagctcagctctatgg
gagaagctgaatggcagcagtgtcagtgtggcatctgccgtcctccctgaagggctagaa
actccaatcacacaaagtgattcagatgatttccgtgtccggaccggtcctaatacagga
gacacatacggagagccaccctttgctcccgctcgaaagtcacggacaatgcaagttcta
ggcgttgaaagctgtgtagatccgccacggctaaaatcgaacagcactcgatccaggtcg
aaacccaagtcagcatcagctgaggaaccagtttccagcaaagaaactacatcttctcag
cagaatgcttcggcaatggagcgcaaaagaacagtatcaggacatatagctcctacgaac
acagcacagcaaccggttgaacccggtgcgccccagcgacgaagcgttcgtttgttcaac
caaatacggccgacaagcaagttctctacatctgcagccagtctgggaactcgtgaagga
cgagagataaaaaaagcaaagtctaccagctcgaagagccgcagcaccgccacagctgct
cctctgggacgatcaacaacctcgtctcgaaaacacggagtcgaatcaacagaaactgac
agcaaggaaagccggtcgaatggaacctcgtcagagtctcttaacgggccgtcgagacct
caagtgccggataagtccaaggagattgatgctcttgcatggacactggatctcttttca
aggctggcgagcgggcacgcggcactgtgtagctacaggtgccaggatgctctccagata
tacaattctttaccgcaaaaccaacgggaaacaccgtgggtattgtcacagattggtcgg
gcgtattacgaacaggccttatacagtgatgctgaaaaatacttctccagggtgcgaaca
atagcaccatcacagttggaaggaatggaggtgtactcaacggtgctctggcacctgaag
aacgaagtcgaactggcataccttgctcatgagctgatggataccgatcgcctggcaccc
gaatcctggtgcgcaattggaaactccttctctctgcagtcagatcatgaccaggcgttg
aaatgcttcagacgagcaacacaggtagatcctgcgttcgcttacggctacactctccag
ggacacgaatacatgtcgaacgaggaatacgacaaggcccaggatgcataccgcgccgcc
atcaaagccaaccccagacactacagcgcctggtacggtctcggcaaggtctacgagcga
atgggcaaactcaggttcgccgaacaacatctccgcaccgcttcgaacataaatcccgcc
aatgttgttttgatatgcagcattggtctcgtcctcgagcgccagaataatctcaaggcc
gcgctgttgcagtacagtcgagcctcgtcactttcaccccactccgtgctggctcgatta
cgcaaagcacgaacgttactaaagctcaatgaggtgaatctcgctcacgtagagctaaag
gtgctcaaggatgtggctcccgacgagccaaatgtgcattatctgttgggcaagttatat
aaaatgatacaggataagggcaacgcaataaaacactttaccaccgccctgaacttggat
ccaaaggccgctcaattcatcaaggaagccatggagtcccttgaaaaccctgatgacgtt
gatgacgacatgacatga

DBGET integrated database retrieval system