KEGG   Arthroderma benhamiae: ARB_04930Help
Entry
ARB_04930         CDS       T01611                                 

Definition
pyruvate carboxylase, putative
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
abe  Arthroderma benhamiae
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    ARB_04930
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ARB_04930
   00640 Propanoate metabolism
    ARB_04930
  Lipid metabolism
   00061 Fatty acid biosynthesis
    ARB_04930
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    ARB_04930
Enzymes [BR:abe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     ARB_04930
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     ARB_04930
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2165 aa AA seqDB search
MAGRGHASENPKLPESLAASPKKIIFIGPPGNAMRSLGDKISSTIVAQHAGVPCIPWSGT
GVDEVKIDEEGIVTVEDTVYDQGCTHSPEEGLKKAREIGFPVMVKASEGGGGKGIRKVDS
EENFEALYNAAASEIPGSPIFIMKLAGNARHLEVQLLADQYGNNISLFGRDCSVQRRHQK
IIEEAPVTVAKQTTFQEMEKAAVRLGRLVGYVSAGTVEYLYSHADDKFYFLELNPRLQVE
HPTTEMVTGVNLPAAQLQIAMGLPLHRIRDIRLLYGVDPNTSSPIDFGFSNEESTMVQRR
PQPKGHTTACRITSEDPGEGFKPSSGTMHELNFRSSSNVWGYFSVGTAGGIHSFSDSQFG
HIFAYGENRSASRKHMVVALKELSIRGDFRTTVEYLIKLLETPAFEDNTITTGWLDELIT
KKLTAERPDPMVAVICGAMTKAHLASEACESEYRKGIEKGQVPAKDVLSTVFPIDFIYEG
SRYKFTATRSSIDSYHLYINGSKCTVGVRALADGGLLILLDGRSHNVYWKEEAAATRLSV
DGKTCLLEQENDPTQLRTPSPGKLVKFTVENGEHIRAGEAFAEVEVMKMYMPLIAQEDGV
VQFIKQPGATLEAGDILGILALDDPSRVKHASPFTGQLPELGPPQVLGNKPPQRFMVLLK
ILQDILLGYDNQVIMGSTLNELVQVLRNPELPYGEWNAYASALHSRMPQKLDAQMTQVID
RAKARKADFPAAQLLKTVTRFIDENVKAAADAEALRTTIAPLLQIIERYKDGLKVQEYKI
IVSLLEQYWEVERLFAQGNTRDESVILKLRDENKDDISKVIQIVLSHSKIGSKNNLILAI
LDMYRPNKPNVGNVANYLKAILRKLAELESRATAKVALKAREVLIQCALPSLEERVAQME
HILRSSVIESKYGETGWDHREPDLNVLKEVVDSKYTVFDVLPLFFAHNDQWVSLAALEVY
VRRAYRAYALKGIEYHNTGDAPFFVSWDFILRKVPHSEFGLSSQSTTSSVPGTPISEMNP
FKKIGSISDMAFANKGSDEATRKGVLIPVHYLDEAEEVLYKALSVFPRSTPAAAKPKKSG
TLPDRSKPAPRSESDEELSGVCNVAIRDVEDLDDSELSSRLTALVNDAKSELLARGIRRL
TFVCGHEDGTYPGYFTFRGPTYAEDVSIRHSEPALAFQLELGRLSKFKIKPVFTENRNLH
VYEAIGKGPELSDNAVDKRYFTRAVVRPGRLRDDIPTAEYLISEADNLMTDILDALEIIG
NNNSDLNHIFINFTPVFPLQPVDVEKALAGFLERFGRRLWRLRVTGAEIRILCTDPATGT
PYPLRVVITNTSGYIIQVELYVERKSEKGEWIFHSIGGTTKIGSMHLRPVSTPYPTKEWL
QPKRYKAHLMGTQYVYDFPELFRQAFQNSWTTAIAAHPALAEKRPALGTCIEYSELVLDD
RDNLAEVSREPGTNTHGMVGWLITAKTPEYPRGRRFIVVANDITYQIGSFGPQEDKFFYQ
CTELARKLGIPRIYLSANSGARIGMADELMSQFNVAWNNPDKPENGFKYLYLTPEVEKRL
EKEKKKDLITELITEDGEERYKITTIIGAKDGLGVECLRGSGLIAGATSKAYEDIFTITL
VTCRSVGIGAYLVRLGHRAIQVEGQPIILTGAPAINKLLGREVYTSNLQLGGTQIMYKNG
VSHMTANDDFAGITKIVEWMSFVPEKKGAPIPIRPSSDPWNRDITYCPPPRQPYDVRWII
GGKEDDEGFLSGLFDKGSFEEALGGWARTVVVGRARLGGIPMGVIAVETRSVDCVTPADP
ANPDSMEVLSTEAGGVWYPNSAFKTAQALKDFNNGEQLPVMILANWRGFSGGQRDMYNEV
LKYGSYIVDALVKYEQPIFVYIPPHGELRGGSWVVIDPTINPDQMEMYADVEARGGILEP
EGIVNIKYRRDKQLDTMARLDPEYGALRESLKDKSHSPEKLSEIKAQMTEREERLLPVYM
QIALQFADLHDRAGRMEAKGTIRQPLEWKNARRFFYWRLRRRLSEEIILKRMAAATVSSA
TSSQASSSPPSSPIPTHSDAPPQINTSSITTPRTQRDENLDKLKAWTGISDDEFESNDRE
VAIWYEENKKNVYEKIEALKTDGIAAEVASLLMGNKEGGLRGVQKVLSMLPDNEKAAVLK
YLGSS
NT seq 6498 nt NT seq  +upstreamnt  +downstreamnt
atggccggcaggggacatgcgtctgaaaaccccaagctccctgaatccctcgccgcttca
cccaaaaagatcatcttcattggcccccctggtaacgcaatgcgctctctcggagataag
atctcttctacgatagttgctcagcacgcgggggttccctgcattccgtggtcgggcacg
ggcgtagatgaggttaaaatcgatgaggaaggcatcgttactgtggaggacactgtttat
gatcaaggatgcacccactctcctgaggaaggtctcaagaaggctcgagagattggcttt
ccagttatggttaaggcctccgagggtggtggtggtaagggtatccgcaaggtcgatagc
gaggagaactttgaggccctctacaatgccgctgctagcgaaattcctgggtctcctatc
ttcatcatgaagcttgctggaaatgctagacatctggaagtccagcttctcgctgatcag
tacggcaacaacatctcactcttcggccgtgactgttccgtccagcgaagacaccagaaa
attatcgaggaagctcctgttaccgttgctaagcagactaccttccaggagatggagaag
gccgcagttcgtctcggtcgtctcgttggttacgtttctgctggtaccgtggaatatctc
tattctcatgccgatgacaagttttacttccttgagctcaaccctcgtttgcaagtcgag
catcctaccactgagatggtcactggtgtcaacctcccagccgctcagctgcagattgcc
atgggtctccctcttcaccgcatccgtgacattcgtctcctttatggcgtggatcccaat
acctcctctcctatcgacttcggcttctcaaacgaggagagcactatggtccagcgtcgt
cctcaaccaaagggccacaccactgcttgccgaatcacctccgaagacccaggtgaaggt
ttcaaaccctctagcggtactatgcacgagctgaacttccgaagttcctccaacgtttgg
ggttacttctctgtgggcaccgcgggcggtatccacagcttctctgattcccagtttggt
cacatcttcgcgtacggagagaaccgctctgcttccagaaaacacatggttgttgcactc
aaggaactgagcattcgtggtgactttaggaccactgttgagtacctcattaaactgctt
gaaacccctgctttcgaggacaacaccattactactggatggctggatgagcttattacc
aagaagctcactgctgagcggcctgatcctatggttgccgtaatctgcggtgccatgacc
aaggctcatctcgccagtgaagcctgcgagtctgaataccgcaagggtattgaaaagggc
caggtgcccgccaaagacgttctgagcaccgtgttcccaattgacttcatctatgaaggt
tcgcgctacaagtttacggccacccgctctagcatcgatagctaccacctctatatcaat
ggcagcaagtgtacagttggtgttcgggctctggctgacggtggtcttcttattcttctt
gacgggcgaagccacaatgtttactggaaggaagaagctgcggccacccgtctatctgtt
gatgggaagacctgtctccttgagcaagaaaatgaccctacgcagctccgaacacctagt
cctggtaagctggttaagttcaccgtcgagaacggtgagcatatccgtgctggtgaggct
ttcgccgaagtcgaggtcatgaagatgtacatgcctttgatcgcccaggaggatggtgtc
gtccaattcatcaagcagcccggagccacccttgaagccggtgatattctgggtatcctt
gcgcttgatgacccatcccgagttaagcatgcctctccattcacgggccagctacctgag
cttgggccaccacaggtactcgggaacaagcccccacagcgcttcatggttctcctcaag
attctccaggacatccttctcggatacgataaccaggttatcatggggagcaccttgaac
gaacttgttcaggtcttgcgtaaccctgaacttccctatggtgaatggaacgcctatgcc
tctgctttgcactctcgtatgccccagaaacttgatgctcagatgactcaggtcattgac
cgtgcaaaggctcgcaaagcagatttcccagctgcccagcttctcaagactgtcacccgt
tttatcgatgagaacgtcaaggccgcagctgatgccgaagctctgcgaaccaccattgct
ccgcttcttcagatcattgagcgatacaaggacggactcaaggtccaggagtacaagatc
attgtctccctcctcgagcaatactgggaagttgagcgtctgttcgctcagggaaacacc
cgtgatgagagtgtcatcttgaaactccgtgatgagaacaaggatgatatctcaaaggta
atccagatcgtcctctcgcatagcaagataggatccaagaacaatctcatcctcgcaatc
cttgacatgtaccgtcctaacaagccgaatgtcggcaatgttgcaaactacctcaaagct
atccttcgtaagttggctgagcttgagtctcgcgctactgccaaggttgctctcaaggct
cgtgaggtgcttattcagtgtgccctgccatctctcgaggagcgagttgctcagatggag
cacatcttgcgttcatccgtgatcgaatccaaatatggtgagactggctgggatcacaga
gaacctgacctcaatgttctcaaggaagtcgtcgattccaagtataccgtctttgatgtt
ctgcctctcttcttcgcccacaatgatcaatgggtatccctcgctgcattggaagtttat
gtccgccgtgcttatcgtgcctacgctttgaagggtattgaatatcacaacactggcgat
gcaccattttttgtctcctgggatttcatcctgcgcaaggttcctcactctgaatttggg
ttatcttctcaatcaaccacttcgtctgttccaggaacaccgatttcggagatgaacccc
tttaagaaaatcggatcaattagtgacatggccttcgccaacaaaggatctgacgaggcg
actagaaagggtgtcttgattccagttcactatctcgatgaggcagaggaagttctatac
aaagctctcagtgtcttcccgcgttccactcccgccgcagccaagccaaagaagagcggt
accttgcctgaccgtagcaaacctgcgccacgctctgaatccgatgaagaactctccggt
gtttgcaacgtggctatccgtgacgttgaagatttggacgactctgagctgtcttcgcgt
ctcactgctcttgttaacgatgcaaagagtgaattgctcgctcgtggaatccgccggctc
acttttgtttgcggtcatgaggacggtacttaccctggttacttcactttccgtggtcct
acttatgccgaagacgtgagtatccgtcacagcgagccagcacttgctttccagcttgaa
cttggccgtctatccaaattcaagatcaagcctgtcttcaccgaaaatcgtaacttgcac
gtttatgaggctatcggcaagggaccagaactcagtgacaatgccgttgacaagcgctac
ttcacccgtgccgtcgtccgccctggcagactacgtgatgacattcccaccgcggaatat
ctcatttctgaagccgacaacttgatgactgatattcttgacgcccttgagatcattggc
aacaataactctgatctcaatcatatctttatcaacttcactcccgtcttccccttgcaa
ccagttgatgttgagaaagccctcgctggtttccttgaacgtttcggtcgtcgtctctgg
cgtctacgtgtcactggtgccgaaatccgtatcctttgcaccgacccagctaccggcaca
ccttacccactccgagttgttatcaccaacacttcaggctatatcatccaggttgaactt
tacgtggagcgtaaatctgaaaaaggcgaatggattttccattctatcggcggcactacc
aagattggatccatgcacttacgtcctgtctctaccccttatcctaccaaagagtggctg
cagcccaagcgttacaaggcccatctgatgggtactcaatacgtgtacgatttcccagag
ctgttccgtcaggctttccagaacagctggactactgccattgccgcccatcccgctttg
gctgagaagagacctgcgcttggaacctgcatcgaatattctgaactcgttcttgatgac
agggacaacctcgctgaagtttctcgtgaaccaggcactaacacccacggaatggtcggc
tggttgatcactgctaagaccccagaatatcctcgtggacgacggtttattgtcgttgcc
aacgatatcacttaccagattggctctttcggaccacaagaggataaatttttctaccaa
tgtacagaattggctagaaagctgggcattcctagaatctatctttctgctaactctggt
gcacgtatcggcatggctgatgagctcatgtctcagttcaatgttgcttggaacaacccc
gacaaaccagagaacggattcaagtatctctacctcaccccagaggttgagaagcgtctc
gagaaggaaaagaagaaggatctgatcaccgagttgattaccgaggatggtgaagagcgc
tacaagatcaccactatcattggagctaaggacggtcttggtgttgaatgtctccgaggt
tcggggttgattgccggtgccacatccaaggcatacgaggacatctttactatcactctt
gttacctgtcgttccgttggaatcggtgcatacctcgttcgcctaggccatcgtgccatc
caggttgagggtcaacccatcatccttactggtgcgccagctataaacaaactccttggc
cgtgaagtatatacctccaacttgcaacttgggggtacccaaatcatgtacaagaacggt
gtctcgcacatgactgctaacgatgactttgctggtatcaccaaaattgtggagtggatg
tccttcgtccctgagaagaagggcgctccaatcccgatccgcccttcctctgacccctgg
aaccgagacattacttattgccctccacccaggcagccctatgatgtccgttggatcatt
gggggcaaggaagatgatgaaggattcttgtctggtctattcgacaagggctccttcgaa
gaagctctcggtggctgggctagaaccgtcgttgtcggccgtgctagactcggtggtatc
cctatgggtgttattgctgtcgaaactcgatctgtcgactgtgtcacccctgccgacccc
gccaaccctgattctatggaagttctgtccacagaagctggaggggtctggtaccctaac
tctgcattcaagactgcgcaagccctcaaggactttaacaacggtgagcagctacctgtc
atgatcctcgctaactggcgtggtttctccggtggccaacgtgacatgtacaacgaggtt
cttaaatacggttcctacatcgtcgatgcccttgttaagtacgagcagccaatcttcgtc
tatattccaccacacggtgaactccgtggtggttcttgggtcgttattgacccaactatc
aaccccgatcagatggagatgtatgccgacgttgaggcccgtggtggtattctcgagcct
gaaggtatcgtcaacatcaaataccgcagagataaacagcttgataccatggcccgcctg
gatcccgaatatggtgctctccgtgaatctctcaaggacaagtctcatagcccagagaaa
ctttctgaaatcaaggcccagatgaccgagcgtgaagagaggctcctccctgtctacatg
cagatcgccctgcaattcgctgaccttcatgaccgcgccggccgtatggaagccaagggt
actatccgacaaccgctcgaatggaagaacgcacgtcgcttcttctactggcgtctccgc
cgtcgtctaagtgaagaaattatccttaagcgcatggccgcggcgactgtttcttccgcc
actagctctcaagcctcatcctcccctccctcatctcccatcccaactcactctgacgct
cccccccaaattaatacatcaagcatcaccaccccgcgcacccagcgtgacgagaacctt
gacaaactcaaggcctggactggaatctctgacgatgaattcgagtctaacgatcgtgag
gtcgccatctggtacgaagaaaacaagaagaacgtctacgagaagatcgaggctctcaag
accgacggaattgctgcagaggttgcgtctttgctcatgggcaacaaagaaggcggtcta
cggggtgtacaaaaagtcctcagcatgcttcctgacaatgagaaggctgctgtactgaaa
tacttgggttcatcttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system