KEGG   Arthroderma benhamiae: ARB_05125Help
Entry
ARB_05125         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
abe  Arthroderma benhamiae
Brite
Enzymes [BR:abe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     ARB_05125
Protein kinases [BR:abe01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   ARB_05125
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 684 aa AA seqDB search
MGRGPVPKFQSIKCISELQPRINKQPAFRRANPEGGFISPLQALTTHLPATYRICNPTFK
YESSRNPRRVLTKPSKGVKNDGYDNDDSDYILYVNDILGSEEANHKYDALDTLHTSSPQQ
HTDSLSTRNRYLILDVLGQGTFGQVVKCQNLKTQEVIAVKVIKNRTAYFNQSMMEVSVLD
LISSKLDKNDDHHLLRLKDTFIHRQHLCLVFELLSVNLYELIKQNQFRGLSTTLVRVFAQ
QLLNGLALLNKARLIHCDLKPENILLKKFYRSPEVLLGLPYSSAIDMWSLGCIVVELFLG
LPLFPGSSEYNQIARITEMLGLPPVWMLENGKQAGEFFEKTQDEFGRQSFRLKSMEQYSR
EHNTKEQPSKKYFQATTLPEIIRSYAMPRKNMKQAEIDREMNNRVAFIDFVRGLLSINPL
ERWSPQQAKLHPFITQQKFTQPFVPPVHLKSSVINKSVAPGVQQQQQAEAASKQRAQAAQ
AQAAQAQANSAAAAAAQSAYALQMNQFNTPHNQPPPVYNNMYNSQQQQQHPAPPPQQQPQ
QQQGPPPPYPTQQGYQMPIMQSGHMSMPPQQTQYGSSQNLYAQATTRAGRQRATTMDQQQ
SGIPPSIQRVASHLDPNSPIRLQPSPAYYPPPADGYPDASGPGQRRTSRARNNGSHGRNR
DFIRSLEDGALGDGFMNQNQNQWH
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgggcaggggtcccgtaccaaagttccagagtatcaaatgcatcagtgagctacaacct
aggatcaacaagcagccagctttccgacgagcaaacccagagggagggttcatcagtcct
ctacaagccctcacaacacatctaccagcaacatatcgaatttgcaacccgaccttcaag
tacgaatcatctaggaatcctcgacgtgtgctgacgaagccaagcaaaggtgtcaagaac
gatggctacgataacgacgatagcgactatattctttatgtcaacgatattctcggcagt
gaggaagcaaaccacaagtacgacgctcttgacacattgcacacgtcgagtccacagcag
catactgactccttgtcaactaggaaccgctaccttatccttgacgtcctcggccaagga
acttttggacaagtagtcaagtgtcaaaatctaaagactcaggaagtcattgccgtgaaa
gtcatcaagaataggactgcatacttcaatcagagtatgatggaagtttcggtcttggat
ttgattagcagcaaactagacaagaacgatgaccaccatctacttcgactaaaggacacc
ttcatccatcgtcaacatctgtgcttggtgtttgagttgctcagcgttaatctttacgag
ttgattaagcagaatcagtttcgtggattgagtaccacactcgtgagggtgttcgctcaa
cagttgcttaacgggctcgcactcttgaacaaagctagattgatacattgcgatctaaag
ccggagaacatcttgctaaaaaaattttaccgctcacccgaagttctcctaggattgcca
tattcctcggcaattgatatgtggtccctcggatgcattgttgttgaactcttcctcggg
cttcctctcttccctggatcatcggaatacaaccaaatagctagaataacagagatgctg
ggcttgcctccagtatggatgctcgagaacgggaagcaggctggtgaattcttcgagaag
acacaagatgagtttggccgacagagttttagactgaagagcatggaacaatattctcgc
gagcacaacaccaaggaacagccaagcaagaagtacttccaagctaccacactgccggaa
atcatcaggtcatacgcaatgccgcgaaagaacatgaagcaggccgaaattgacagagaa
atgaacaaccgcgtggcattcattgattttgttcgcggcctcctatccattaaccctctt
gaaagatggtctccgcaacaagccaaactccacccctttatcacgcagcaaaagttcacc
cagcccttcgtcccgccggtccacctcaaatcctccgttattaataagtctgttgctccc
ggagttcaacaacagcaacaagcagaagcagcatccaaacaacgcgcccaagctgcacag
gcacaagcggcccaagcccaagcaaactctgccgctgccgctgccgcccagtctgcttat
gctcttcaaatgaaccaattcaacacaccgcacaatcaacctccaccagtctacaacaac
atgtataattcccagcaacagcaacaacacccggccccgcctccacagcaacagcctcag
cagcaacagggaccaccaccaccctatcctacacaacagggatatcaaatgcccatcatg
caatctggccatatgtccatgccaccgcagcagacacagtatggctcctctcaaaaccta
tacgcgcaagcaactacccgcgcaggtcgacaacgggctacgacaatggatcaacagcag
agtggtattccaccgtctatacaacgggtagctagtcacttggaccccaactcacccatt
cgactccagcctagcccggcgtactacccacctccggcagacgggtaccctgacgcttcc
ggcccaggtcaaagacgaactagccgggcaagaaacaacggttcacacggccgaaataga
gacttcatccgcagtctcgaagatggggcactgggagatggcttcatgaaccagaaccag
aaccagtggcactga

DBGET integrated database retrieval system