KEGG   Arthroderma benhamiae: ARB_05172Help
Entry
ARB_05172         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
abe  Arthroderma benhamiae
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:abe00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 461 aa AA seqDB search
MATPHPTQRAFIALGSNLGDRVAMIEEACREMEARGIKIRRTSSLFETAPMYVVDQGTFL
NGACEVETSKSPMELLDTLQSIEIDMGRRKVIDKGPRNIDLDILLYGHETVSNDRLIVPH
KLMLEREFVLRPLCQLIPNEYPLVEGEGKTYTSHLQALPPSNPPPIAMIPMPAGLPPITP
TKPSRNTLLMAVLNVTPDSFSDGGIHSSTDPTALLETVKAYIDAGVSIIDVGGESTRPNA
EPVTEAEELSRVIPAIELIRSLPEASKIAISIDTYRANVAEAAVNAGADIINDISAGLLD
PEMLPTMARLQKTVMLSHTRGTPKTMNKLTHYPDGVLAGVQSELAERVHAAEQAGVRRWR
IIADPGVGFAKTQDQNLTILRNLDQLRQAEELQYMPWLVGVSRKGFVGRITGVKKAGERT
WGTAAAVTAAISGGADIVRVHDVSEMAQVTRMADAIFRPSL
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggccactccacaccccactcagcgagccttcattgctcttggaagcaacctgggagac
cgtgtagctatgatcgaagaagcatgtcgagagatggaggcgcgaggcattaagattagg
agaactagctctctttttgagactgctccgatgtatgtggtggatcaggggactttcctc
aatggggcatgcgaggtcgagacttcaaaaagccccatggaattactggataccctacaa
tcgatagagattgacatgggaagacgcaaggttatagataagggccctcgtaacattgac
ctggatatcctcctatatggccatgaaactgtctccaacgaccggttaattgttccccat
aagctcatgctcgagcgagaatttgtcttacgtcctctctgccagctgatacccaatgaa
tacccgctggtcgagggggagggcaaaacgtatacctctcacttacaagctcttcctcca
tctaaccctccccccatagcgatgataccaatgcccgcaggccttcccccaatcacacct
acaaagccctcccgtaacactcttctaatggcagtcctcaacgtcaccccggactccttc
tccgatggcgggatccactcttccacagacccaactgcactccttgaaacagtcaaggca
tatatagatgccggagtctccattattgatgtaggaggcgagagcactcgccccaacgct
gaaccagtcactgaggcagaagaattatcccgtgttataccggctatagaactcatcaga
tctctgcctgaagcgtcgaagatcgcaatcagcattgacacataccgtgctaatgtagct
gaagcagctgtcaatgcaggtgcggatataataaacgatatatcggctggcctcctcgat
ccagagatgcttcctactatggcccgactgcagaaaacagtcatgctgtcacatacgcga
ggaacaccaaagacaatgaacaaactcacacattaccctgacggtgtgctagccggagtc
caatctgagctagctgaacgtgttcatgccgctgaacaggcaggtgttcgacgatggcgc
atcattgccgacccgggtgtcggctttgccaaaacacaggaccagaatttgaccattctc
agaaaccttgaccagttacggcaggcagaggagcttcagtatatgccctggctcgtgggg
gtcagtagaaaggggtttgttggtcgtatcacgggagtcaagaaggctggtgaacgcact
tggggtactgctgcggctgttacggcggccataagcggtggagccgacattgttcgtgta
cacgatgtcagcgagatggctcaggttactcgtatggctgatgccatcttcaggccgagc
ttgtaa

DBGET integrated database retrieval system