KEGG   Arthroderma benhamiae: ARB_05231Help
Entry
ARB_05231         CDS       T01611                                 

Definition
cytochrome P450 oxidoreductase OrdA-like, putative
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
abe  Arthroderma benhamiae
Pathway
Fatty acid degradation
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    ARB_05231
  Amino acid metabolism
   00380 Tryptophan metabolism
    ARB_05231
Enzymes [BR:abe01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     ARB_05231
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     ARB_05231
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1057 aa AA seqDB search
MSEPIPGPAPLPIVGNAYNLDLVNSFTTFGNLTDTYGPIFKLTLGGEEKIFITTQSLMDE
VCNEKRFSKLVAGSLAQIRNGVQDGLFTAHPGEHNWEIAHRVLMPAFGPSSIRAMFDEMH
DIASQLVIKWARFGPNEKIHVTDDFTRLTLDSIALCAMGTRFNSFYHEDMHPFVHAMVGF
LAESGARASRPAVVQYFMHSAQQQYDADIELMKKVAGDLVADRKANPNDKKDLLNAMLKG
KDARTGEHMTEDSIMNNMITFLIAGHETTSGLLSFLFYYLLKHPSAYQAAQRQVDEVVGR
GPITVEHMSKLPYIEACMRETLRLSPSAIAIQMQPRPDGQEDPIYLGKGKYEIKKGQAIV
CVIPQIHRDPTVYGDDANLFRPERMLDEPFAKLPKNSWKPFGNGVRGCIGRPFAWQETIL
TAVMLLQNFNLRFDDPSYQLQIKQTLTIKPKDFFMRATLRHNVDPVQLEKMLHVNIEAEA
KAGEKDRAAGISSVGPAKKPMTILYGSNAGTCEALAQNLARDASSRGYSAQVGPLDSGVD
KVPKDQPVIVISSSYEGQPPDNAAHFVEWIQGLGSGAMTGVKYAVYGCGNHDWTSTFHRI
PKLLDAEFKRCGATRVADVGLGDVADGDIFNHFDKWQDEQLWSSIGGDVDPAEEGTVEVD
IDTDARKSTLRQDVREATVISNKVLTAPGEPEKRHLILTLPTGMSYKSGDYLARNIRRAL
NRYNLPWDAMLTIKVGANTTLPTGHPVSAMDVLSAYVELGQPATRKNVARIASSISDEKV
REEVLALSKEGFENEILKKCRSPLDLLEEYPTAELPLGDFLAMLPPMRIRQYSISSSPLA
DPTVASITWSVLDAPSRVADSKRFLGVASNFLSKVQEGDRIHVAVKPSHGNFHPPKDTEN
TPLMMFCAGTGLAPFHGFVQERAIQIQAGRKVAPAYLFIGCRHPERDALFKDELQKWETD
GVVTVFYAFSAASEQSKHCRYVQDRLWEERGEMRKVFDQGAKLYVCGTSRVGEGIASTVK
KIFQDYCASVGKPKTDEEVERWFQDIKSDRFSSDVFA
NT seq 3174 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaccgattcctgggccggcaccgttgcccattgtcgggaatgcttataacctt
gatcttgtaaactcctttaccacctttgggaacctcacagatacatatggaccaatcttc
aagcttaccctgggtggtgaggagaagatcttcatcaccactcagtccttgatggatgag
gtctgcaatgagaagcgattctcgaaactcgtcgctggcagtctggcccagatcagaaac
ggagtccaagacgggctcttcacagctcacccgggggaacacaactgggagattgcacat
cgtgttttgatgccagcgtttggcccatcatcaattcgggccatgttcgatgagatgcat
gatattgcatcacagctagtgattaaatgggcgcggtttggtcccaacgagaagatacat
gtcacagatgatttcacgcggctgactcttgactctatcgccctatgtgccatggggacc
cgattcaactcattctatcatgaggatatgcacccctttgttcacgccatggttgggttc
ttggccgagtctggagccagagcaagtcggccagctgttgttcaatactttatgcactca
gcacaacaacaatatgatgccgatattgagctgatgaaaaaggtcgccggggacctggtt
gcggatcggaaagccaaccccaacgacaaaaaggacctgctcaatgccatgctcaagggg
aaggatgctagaaccggagaacatatgaccgaagatagtatcatgaacaatatgataacc
ttcttgattgctggccacgagacaaccagcggccttttgtcgtttttgttttattatctc
ttgaaacatccatcagcgtaccaagctgcgcagcgtcaggtggatgaagtcgtgggccgt
ggacctattactgtcgagcatatgtcgaagttgccttacatagaggcttgtatgcgtgaa
actctcagactttcaccttctgcaattgctatccaaatgcagccccggccagacggtcag
gaggatcctatttaccttggcaaggggaagtatgaaattaaaaagggccaggcaattgtt
tgcgtcatccctcaaatccatcgtgacccaacagtgtatggagacgatgccaacctcttc
aggccagaaaggatgctggatgaaccttttgctaagctccctaaaaattcctggaaacct
tttggtaatggtgtacgtggatgtattggaaggccatttgcatggcaggagaccatctta
actgctgtaatgctcctccagaacttcaacctgcgatttgacgacccaagctaccagctg
cagataaaacagacacttacgattaagcccaaggacttttttatgcgcgcgacgctaaga
cacaacgttgaccctgttcagctggagaagatgcttcatgtgaatatagaggcagaagct
aaggccggagagaaggacagggcagccggcatctcctctgttggaccggcaaagaaaccc
atgacaatactttacggctcaaatgcaggaacttgtgaggcgctggcacagaacttggct
agagatgcctcgagcagaggctatagtgcacaagttggccccttggattcgggtgttgac
aaagtacccaaggatcagccagtgatcgtcatatcgtccagttatgaagggcagccacca
gacaatgccgcacattttgtcgagtggatccaagggctcgggagtggtgcaatgaccgga
gtgaaatacgcagtttatggctgcgggaatcatgattggacctcgacgtttcacagaata
ccaaaactcctggatgcagagttcaagaggtgcggtgcgactagagtcgctgatgttggc
cttggggacgtagcagatggggatatcttcaaccacttcgataaatggcaagacgagcag
ctttggtcctctatcggcggcgacgttgaccctgccgaagagggtaccgtggaagttgac
atcgatacagatgctcggaagtctaccctccgtcaggacgtgagagaagcaactgtcatc
agtaataaagtactgactgcacccggagaaccagagaagaggcaccttattttaacgctt
cctaccgggatgtcgtacaagtctggggattatcttgccaggaatatccgacgagccctg
aaccgttacaacctcccgtgggacgcaatgttgacaatcaaggttggtgctaatactacc
ttgccaacgggtcaccctgtttctgcaatggatgtattgagtgcatatgtcgagctgggc
caaccagcgacgagaaagaacgttgctcgaatcgcttccagtatatcggatgagaaggtc
cgtgaggaagtccttgctctttcaaaggaaggatttgaaaacgagattttgaagaaatgc
cgctctccgttggatcttctcgaggaatatccaacagccgagctgcctcttggagacttc
cttgcaatgctgccaccaatgcgcattcgccaatattcaatttcctcctcgcccttggca
gacccaacagttgcgtctattacttggtcagttctcgatgcgccgtctcgggttgccgat
tcaaagcggttccttggtgtggcatccaacttcctctccaaagtccaggagggcgatagg
atccatgttgccgtgaagccaagccatggcaacttccaccctcccaaggacaccgaaaat
acacctctcatgatgttctgtgccgggactggccttgcccctttccacggttttgttcaa
gagagagccatccagatccaagcgggccgaaaagtggcccccgcgtaccttttcatcgga
tgcagacatcccgaaagagacgctctgttcaaggatgagcttcagaaatgggagactgac
ggcgtagtgacggtgttttatgcattttccgcagcaagtgagcaaagcaagcactgtcga
tacgtccaagacaggctgtgggaggaaagaggtgagatgagaaaggtctttgaccaggga
gcaaagctgtatgtttgcggcactagcagggttggagaaggcatcgcatctaccgtgaag
aagatattccaggactattgcgcttctgttggcaagccaaagacggacgaagaggtagag
cgctggttccaggatatcaagagcgaccggttttcctcggacgtcttcgcataa

DBGET integrated database retrieval system