KEGG   Arthroderma benhamiae: ARB_05267Help
Entry
ARB_05267         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
abe  Arthroderma benhamiae
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:abe00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    ARB_05267
Enzymes [BR:abe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     ARB_05267
Peptidases [BR:abe01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   ARB_05267
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1074 aa AA seqDB search
MVEPAEPIWGAGDGAPVPGAGRPPYPSMKELQNMAACLNLGEDPSLNELLHISEDAISKS
KTLAQRGKYDSALVYYLRASDITVNMIPRHPDFTYMKQNHPRWADQFARLMMLVDSQHKT
MEDIKRKITESNNAAGHSRSTSTPSSAPLRMPSPTNFHRQPLNTTSHSSGGSRPASESIP
VQDPLAQRLAGLRNHRHPGSSPSNEGANGSSYSTSSTNGNYSTYRSHLHSQAHSGQRSPV
PSKPLGPREMNPSVPTVPPKVPISGVDAPLPRYPSPAYNPMWTVPSIPTPNPPRTSVESI
RNTIYKQTNTGATNSNSSLNTSTDNPYRSQTPNGIRPEADSGNRSPDIYVGPTITATKLV
EYIRKYDVLLIDVRSRDQYDAGHIYAKSILCIEPVVLKENISAEELEDRLIISPDTEQSL
FNRRNEFDLIVYYDQSTVEPTYLIGSPAGSAVPHLRALYDTLYEFNFYKPLKGGRPPALL
VGGLDAWVDLVGPQSLATSQTSAILSSVRARRQAPDSSQPLRRNPTVSANSSWEVRKRRL
RDYKPLNPEEERAWLEKAKDEEIDTSYVAEEGDITEEPEDIDGSTLRQTASFVHSYEDFL
RRFPEPNDIRESMVHAGNAVQFPLYDAAAVPAPSRPPPAIPRPSYSGVADRGQTQPPLAR
QSSAHKQALYSSPIDRLRLPRTGLINLGSTCYMNSIIQSLSATVLLTKFFVDNRFHAQVQ
KNWKGSQGVLPGLFANLIRSLWKNDVEVIRPTSFRKFVGRLNTEWAGSQQQDAKEFFDVL
VDCLHEDLNLRWQRTPLRPLTFAEEMRREQMPIHKVSEIEWARYSHRELSYVSSLFAGQH
ASRLRCTTCRKTSTTYEAFYSISVEIPVTGTGDIYQCLKSYCQEEVLSGDEVWKCPYCKR
EREAAKQIILTRAPRFLVFHFKRFSASRRQQARKIHTPVSFPLSGLDMTPFMIQHPQHSQ
SSRPVSPLPDGNDDKLDSKSNSHAPLKSQSALQTNELATSSPYIYNAYAVVRHIGSTMNE
GHYISLVRDEQRRCWRKFDDQRVTDFQPSSSRSSPDNLQNEQAYLVFYERAPAN
NT seq 3225 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaaccagcggagccgatttggggtgccggagatggagctcccgtcccaggtgcg
ggtaggcctccctatccctcgatgaaagaattgcagaacatggcagcttgtttgaacttg
ggtgaagatccatcgctaaatgagctattacatatctccgaagatgccatcagcaagtcc
aaaaccctcgcccagcgagggaaatatgattctgctctcgtctattacctccgtgcctct
gatatcactgtcaatatgattccccgccacccagatttcacgtatatgaagcagaatcac
ccaagatgggcggaccagtttgccaggctaatgatgctcgttgattcacagcacaagacg
atggaagacattaagcggaaaatcacagaaagcaacaacgccgcaggacactcacgctcg
acgtcaactccatcttctgctccgctacgcatgccaagccccaccaactttcacaggcag
ccattaaacaccacttcgcatagctcaggaggcagcaggcctgccagtgagtcgatacct
gtgcaggatccccttgctcagagacttgcaggcttgagaaaccatcgacatccaggcagc
agcccatcgaacgagggagcaaacggctcttcctactctaccagtagcaccaatgggaac
tactctacctaccggtcacacctacactcacaggctcattcaggacagcgcagtcctgtg
ccttcgaaaccactggggccccgagagatgaacccatctgtcccgactgtccctccaaag
gtccccatctctggtgtagatgcacctctccccagatacccaagccctgcctataaccct
atgtggaccgtgccctcaataccaactccgaaccctcctaggacatccgtcgaaagcata
cgcaatactatctacaaacagacaaacaccggagcaacaaactccaacagcagccttaac
acctctacagataacccgtaccgctcgcaaactccaaacgggatccgccccgaggctgat
tctggaaacagaagcccggacatctatgttggccccacgattactgctacaaagctggta
gaatacattcgaaaatatgatgtcctgctcatcgacgttcggtcacgcgatcaatatgat
gccggtcacatatatgccaagtccatcttgtgcattgagccagtagtgttgaaggagaac
atatctgcagaagagcttgaggatcggctgattatctcacccgacacagaacagtcatta
ttcaacaggcgaaacgaatttgaccttatcgtctactatgaccaaagcaccgttgagcca
acatatttgatagggtctcccgctggaagtgcagttccacatctgcgagctctctatgat
actttatatgagttcaacttttataagccgttaaaaggtggccgacctccagctctttta
gttggtggtctagatgcatgggttgacttggtcgggccacaatctctagctacgtcccaa
accagcgcgatactaagctctgtccgtgctagaagacaagcgcctgattccagccagcct
ttgcgcagaaatcctactgttagcgcaaattcaagctgggaggtgagaaagaggaggctg
cgtgattataagcctctcaaccctgaagaagaacgagcctggctcgaaaaggcgaaggac
gaggagatagacaccagctacgttgctgaggagggggacattactgaagaaccagaagat
atcgacggatccactctacggcagacagcatcattcgtacatagttacgaggactttctt
aggaggttccctgagccaaacgacatccgagagtctatggtacatgcgggaaatgcagta
caatttccactgtacgacgctgcagccgtaccagctccgtcgaggccaccacccgccatt
cctcgacccagctatagtggtgtggcagaccgtggtcagacgcaacctccgcttgctcgg
caatcatctgcccataaacaagcgctatactcttcccccatagatcgactgaggctccct
cggactggccttatcaacctgggctcaacctgttatatgaattcaataatacaaagtctt
agcgctactgtcctccttaccaaattttttgtcgataatcgctttcacgctcaagttcaa
aagaactggaaaggctcgcaaggcgtcttgccgggcttgttcgcaaatctgatacggtct
ttgtggaagaatgacgttgaagtaattcggcctacatcattccggaaatttgttggtcga
ttgaacacagagtgggcagggagccagcagcaagacgcaaaggagttctttgatgtctta
gttgattgtttacatgaagatctcaatctacgttggcaacgcacacctttacggccattg
acctttgcagaggaaatgcgccgagaacaaatgccaatccacaaggtatcggaaatcgaa
tgggcccgatactcgcaccgtgaactatcgtatgtgtcctccctttttgctggacagcat
gccagtcgacttcgctgcaccacatgccgaaagacttccacgacatacgaggcattttat
agcattagtgtcgaaatccccgtcacaggaacaggagatatttatcagtgcctcaaaagt
tactgtcaagaagaagtactcagtggtgacgaagtttggaaatgcccatactgcaaacga
gagcgagaagccgcaaaacaaatcatcctcacccgagctcctcgcttcctcgtctttcat
ttcaagagattttctgcctccagacggcaacaggcgcgtaaaatccacacgccggtttct
ttcccgcttagcggcctcgacatgaccccctttatgattcaacatcctcaacattcccaa
tcttctcgccccgtctctcctctgccggatggcaacgacgataaactcgattcgaaatcc
aactcccatgcccccctaaaatcccaatcagcgctacagactaatgagctcgctacgtcc
agtccatatatttataacgcctacgccgttgtccggcacattggttcaactatgaatgaa
ggacattacatctccttagttagagatgagcaacgcagatgttggcggaaatttgatgat
caacgagtaacggatttccaaccgagttcttcccgttcttcacctgataacttgcaaaac
gagcaggcataccttgttttttatgagcgggccccagctaactaa

DBGET integrated database retrieval system