KEGG   Arthroderma benhamiae: ARB_05372Help
Entry
ARB_05372         CDS       T01611                                 

Definition
aldose 1-epimerase family protein, putative
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
abe  Arthroderma benhamiae
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:abe00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:abe00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 440 aa AA seqDB search
MCGVLRQLMLLLLAFLSITPSCSAWNFHHQLNGTTPSNGTTTNGSSSCPLANGASSNPLQ
VYTIAANNITASFIPYGARLISLMVPDREGKMQDVIVGYDNPQDYVKDTLTNHTYFGCIV
GRYANRIRNGTFVLDGTTYNTPKNELNKTQTLHGGSVGYDQRNWTVTALSNSSITFTLFD
SGYEHFPGDVINHVTFSVNSSYGLKRPNPQTEFTARTVSLSLTEKTPIMLSPHIYWNLNA
FKNETVLEDTLLELPLSSRYVEVDSRLIPTGNIGNVSSSLNGTLDFTKGKLIGKDIKSAD
GICGANCTGYDNCFIIDRPNNASDWTSSPQTMVPAVNMSSITTGINMLVTTNQQAIQIYS
CNGQNGTIPVKGSQVARNKASGDGNGTVVDKIEQYGCLVIETEGWIDGINNPDWGQDPFQ
IYSPESGPAINWATYVFTAS
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtgtccttcgccaactcatgcttctgctgctagccttcctcagcataacaccc
agttgctcagcatggaacttccatcaccagttaaatggcactacaccttctaatgggacg
actacgaatggctcatctagctgccccctagccaatggagcgtcgtcgaatccactacaa
gtatacaccattgctgcaaataacattactgcatcgttcattccatacggtgcccgtcta
atctccctcatggtccccgatcgtgagggtaagatgcaggatgttatagttggctacgat
aacccccaggactatgttaaagacacactcactaaccatacgtactttgggtgcattgtc
ggacgatatgccaacaggattagaaatggtacatttgtcctagatggaactacatacaat
acaccaaaaaacgagctgaataaaactcagacattacacggtgggagtgttggttatgac
cagcgtaactggactgttacggctctgtcgaatagctccataaccttcaccttgttcgat
tccggctatgaacacttcccgggtgatgtcataaatcatgttactttcagtgttaattcg
tcatatggcttgaaaaggcccaatccacagacagagttcaccgcccgaaccgtttctctc
tctttgacagaaaagacgcccatcatgttgtcacctcatatatactggaatctcaacgct
tttaagaatgagaccgtgctagaggacacgctacttgaactaccactatctagtcgatac
gtggaggtggactcgcggcttatcccaaccggaaacataggaaatgtctcttcctccctc
aatggtaccctagacttcacaaaggggaagttgatcgggaaagatatcaagtccgcagat
ggaatctgtggagcaaattgtactgggtacgataactgcttcattattgataggcccaat
aatgcgtctgactggacttcttccccccaaacaatggtccctgctgtgaatatgtcctcg
atcactacgggtataaatatgctggtcacaacaaatcagcaggcgattcaaatatactcc
tgcaatggtcagaatggcacgatccctgtgaaaggctcacaagtggcaaggaataaggct
agcggggatgggaacggtacggttgtggataagatagaacagtatggctgccttgtcatt
gaaaccgaggggtggattgatggcatcaataacccagactggggtcaggatccgttccaa
atatattctcccgagtcaggtcctgcgataaactgggcaacgtatgtgtttactgcttcc
tga

DBGET integrated database retrieval system