KEGG   Arthroderma benhamiae: ARB_05408Help
Entry
ARB_05408         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K10747  
DNA ligase 1 [EC:6.5.1.1]
Organism
abe  Arthroderma benhamiae
Pathway
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:abe03030]
Genetic Information Processing; Replication and repair; Base excision repair [PATH:abe03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:abe03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:abe03430]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 844 aa AA seqDB search
MAGPLKKKRKVDSTGVPQNTRSIASYFRAGNKATSSQIISTEHHRLTDEQLARKLQKEWN
KKSQDESESSTPGHRATENLQEEKLRASDEVADASSSSDKGSLADTPALTPGKENKPKGI
LSLQSSSTAEDTISFSLPFDLSPLEFDPHEQKEKLQAHWDAEGGKASYAILARAFSLVNG
TQSRIKIVDILVNLLRLIIVGDPQSLLPAVWLATNAFAPPYVPIELGLGGSAISKALKRA
YGLDNQGLKALYNKHGDAGDVAFEAKKKQSFTLRRPKPLTIRSVYDALMKIANSKGTGSQ
ETKQRIVEKLLQDTRGAEESRYIVRTLVQHLRIGAVKTTILIALARAFLYSKPPAATFPL
RSRAELMSLSKEELSNIYSQAEETIKACYARHPNYNMIVPCLLENGVSAELLTKCGITLH
VPLLPMLGSITRDLPQMLTRLHGRSFTCEYKYDGQRAQVHCDAAGKVSIFSRHLELMTDK
YPDLVSLVPQIRSGAVSSFIMEGEVVAVNNETGELLPFQTLTNRAKKNVEIGSIKVNVCL
FSFDLMYLNGQPLLDRTFRERRELLRSLFVEIPNQFTWVKSIDAFPSDSDAVLNFFNDAL
QVKCEGIMVKVLDDKPVDRLLQAEDTATALGDGELLPPEEDKKQESTDTAEKQRGNRKRP
LLSTYEPDKRLESWLKVKKDYSASSETLDLIPIAAWHGQGRKAKWWSPILLAVRNPETGS
LEAVTKCMSGFTDKFYEANKEKYAEGSDNIISRPSYVEYCGEPEVWFQPQEVWEMAFADI
TLSPTYTAAIGLVSDERGLSLRFPRFLRVREDKSIDEASTSDYLAHLWDKQAERAKVAEP
RAGD
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atggccggtcctttaaaaaagaagagaaaggttgattcgactggggtgccgcagaatacc
cggagcattgcttcatattttcgtgcagggaataaagcaacgtcctcgcaaatcattagc
accgagcatcatcggcttacggacgagcagctggcccggaagcttcaaaaagaatggaat
aaaaaaagccaggatgaatctgaatcttccactcctggtcatagagcaacggaaaacctt
caagaagaaaaactgcgagcgtctgatgaagtagctgatgcgagctcaagcagcgacaaa
ggcagcttagctgatactccagctcttacacccggaaaagagaacaagcccaagggaata
ctatctctacagagctcttcaacggctgaggataccatatcattttcattgccttttgat
cttagtccgttggaattcgatccacatgaacaaaaggagaaactccaggcacactgggat
gcggaaggcgggaaagcatcgtatgccattttagctcgtgccttttctcttgtcaatggc
acacagagtaggattaaaatagtggacattcttgtgaaccttcttaggcttataatcgtt
ggtgacccgcagagccttcttcccgcggtgtggttggcaacaaatgcatttgctccgccc
tacgtaccaattgaactggggctaggagggtctgccatatccaaagcattgaaaagagca
tatgggctggataaccagggtctcaaagcactttacaataaacatggcgatgctggcgat
gtggcctttgaagcaaagaaaaagcagtcatttacgctgagacgaccaaagccgttaacc
atcagaagtgtatacgatgcgctgatgaaaattgcgaacagcaaaggcacaggaagtcag
gagacaaagcaaagaattgtcgagaaattgctccaagacacgcgaggtgcagaggagagt
cgatacatcgttcgtacacttgttcagcatctccggattggagctgttaaaacgacgatt
ttgattgcacttgcaagagcgtttctctactcaaaaccgccggcagccacatttccccta
cgttcgcgcgcagagctcatgagcttgagtaaagaggagttatcaaatatctactcccag
gctgaagagactatcaaagcttgctatgcccggcatcctaactacaacatgattgttcca
tgtttattggaaaatggggtttctgctgaacttcttacgaaatgtggcatcacattacac
gttcctttattacctatgttgggtagtattacacgggaccttccgcaaatgttaaccagg
ctacatggccgatcctttacctgcgagtacaaatatgatgggcaaagggcacaggtacac
tgcgatgcagcggggaaggtctccattttctctcgccatttagaactcatgacggataaa
tacccggacttagtgtctcttgtccctcagattcgatctggagctgtttctagctttatt
atggaaggtgaagtggttgctgttaataatgaaaccggagaattgcttccttttcaaaca
ctcacgaatcgggcgaagaaaaatgtggaaataggtagtatcaaagtcaatgtctgttta
ttctcttttgacttgatgtacctgaatggacagcctctgcttgacagaacattccgggaa
agacgagaacttctaaggagtttgttcgttgagatcccaaatcaatttacatgggtaaag
agtatagatgcattcccatctgattcggacgctgttctgaactttttcaatgatgccctt
caagtaaaatgcgagggcataatggttaaagttctggatgataagccagttgaccgcctg
ttgcaggcagaagataccgccacagctcttggtgatggtgaattactacctcccgaagag
gataaaaaacaagagtctacggatactgctgagaagcagcgagggaacaggaaacggccg
ctgctgtcaacatacgagcctgacaaacgcctcgaatcttggcttaaagtgaagaaggat
tatagtgcttcttcggagaccttagacttgattcccattgcggcatggcatggccaaggt
cgaaaggccaaatggtggtctccaatacttcttgctgtgcgaaatcctgaaaccggctct
ctcgaggcagttaccaagtgtatgtccggtttcactgataagttttatgaagcgaataag
gagaagtatgcggaaggcagcgacaatataatctcacggccaagctacgtggagtactgt
ggcgagccggaggtttggtttcaacctcaggaggtgtgggagatggcctttgcagatatc
acgctgagtcctacgtatactgcagccataggcctggttagtgatgaacgcgggctgagc
cttcgattcccaaggttcttgagagtgagagaggacaagagcattgatgaagctagcaca
tccgactatcttgcccatctttgggacaagcaggcggagagagcaaaggtggcggagcct
cgagctggggattga

DBGET integrated database retrieval system