KEGG   Arthroderma benhamiae: ARB_05408Help
Entry
ARB_05408         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K10747  
DNA ligase 1 [EC:6.5.1.1]
Organism
abe  Arthroderma benhamiae
Pathway
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Brite
KEGG Orthology (KO) [BR:abe00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ARB_05408
   03410 Base excision repair
    ARB_05408
   03420 Nucleotide excision repair
    ARB_05408
   03430 Mismatch repair
    ARB_05408
Enzymes [BR:abe01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     ARB_05408
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 844 aa AA seqDB search
MAGPLKKKRKVDSTGVPQNTRSIASYFRAGNKATSSQIISTEHHRLTDEQLARKLQKEWN
KKSQDESESSTPGHRATENLQEEKLRASDEVADASSSSDKGSLADTPALTPGKENKPKGI
LSLQSSSTAEDTISFSLPFDLSPLEFDPHEQKEKLQAHWDAEGGKASYAILARAFSLVNG
TQSRIKIVDILVNLLRLIIVGDPQSLLPAVWLATNAFAPPYVPIELGLGGSAISKALKRA
YGLDNQGLKALYNKHGDAGDVAFEAKKKQSFTLRRPKPLTIRSVYDALMKIANSKGTGSQ
ETKQRIVEKLLQDTRGAEESRYIVRTLVQHLRIGAVKTTILIALARAFLYSKPPAATFPL
RSRAELMSLSKEELSNIYSQAEETIKACYARHPNYNMIVPCLLENGVSAELLTKCGITLH
VPLLPMLGSITRDLPQMLTRLHGRSFTCEYKYDGQRAQVHCDAAGKVSIFSRHLELMTDK
YPDLVSLVPQIRSGAVSSFIMEGEVVAVNNETGELLPFQTLTNRAKKNVEIGSIKVNVCL
FSFDLMYLNGQPLLDRTFRERRELLRSLFVEIPNQFTWVKSIDAFPSDSDAVLNFFNDAL
QVKCEGIMVKVLDDKPVDRLLQAEDTATALGDGELLPPEEDKKQESTDTAEKQRGNRKRP
LLSTYEPDKRLESWLKVKKDYSASSETLDLIPIAAWHGQGRKAKWWSPILLAVRNPETGS
LEAVTKCMSGFTDKFYEANKEKYAEGSDNIISRPSYVEYCGEPEVWFQPQEVWEMAFADI
TLSPTYTAAIGLVSDERGLSLRFPRFLRVREDKSIDEASTSDYLAHLWDKQAERAKVAEP
RAGD
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atggccggtcctttaaaaaagaagagaaaggttgattcgactggggtgccgcagaatacc
cggagcattgcttcatattttcgtgcagggaataaagcaacgtcctcgcaaatcattagc
accgagcatcatcggcttacggacgagcagctggcccggaagcttcaaaaagaatggaat
aaaaaaagccaggatgaatctgaatcttccactcctggtcatagagcaacggaaaacctt
caagaagaaaaactgcgagcgtctgatgaagtagctgatgcgagctcaagcagcgacaaa
ggcagcttagctgatactccagctcttacacccggaaaagagaacaagcccaagggaata
ctatctctacagagctcttcaacggctgaggataccatatcattttcattgccttttgat
cttagtccgttggaattcgatccacatgaacaaaaggagaaactccaggcacactgggat
gcggaaggcgggaaagcatcgtatgccattttagctcgtgccttttctcttgtcaatggc
acacagagtaggattaaaatagtggacattcttgtgaaccttcttaggcttataatcgtt
ggtgacccgcagagccttcttcccgcggtgtggttggcaacaaatgcatttgctccgccc
tacgtaccaattgaactggggctaggagggtctgccatatccaaagcattgaaaagagca
tatgggctggataaccagggtctcaaagcactttacaataaacatggcgatgctggcgat
gtggcctttgaagcaaagaaaaagcagtcatttacgctgagacgaccaaagccgttaacc
atcagaagtgtatacgatgcgctgatgaaaattgcgaacagcaaaggcacaggaagtcag
gagacaaagcaaagaattgtcgagaaattgctccaagacacgcgaggtgcagaggagagt
cgatacatcgttcgtacacttgttcagcatctccggattggagctgttaaaacgacgatt
ttgattgcacttgcaagagcgtttctctactcaaaaccgccggcagccacatttccccta
cgttcgcgcgcagagctcatgagcttgagtaaagaggagttatcaaatatctactcccag
gctgaagagactatcaaagcttgctatgcccggcatcctaactacaacatgattgttcca
tgtttattggaaaatggggtttctgctgaacttcttacgaaatgtggcatcacattacac
gttcctttattacctatgttgggtagtattacacgggaccttccgcaaatgttaaccagg
ctacatggccgatcctttacctgcgagtacaaatatgatgggcaaagggcacaggtacac
tgcgatgcagcggggaaggtctccattttctctcgccatttagaactcatgacggataaa
tacccggacttagtgtctcttgtccctcagattcgatctggagctgtttctagctttatt
atggaaggtgaagtggttgctgttaataatgaaaccggagaattgcttccttttcaaaca
ctcacgaatcgggcgaagaaaaatgtggaaataggtagtatcaaagtcaatgtctgttta
ttctcttttgacttgatgtacctgaatggacagcctctgcttgacagaacattccgggaa
agacgagaacttctaaggagtttgttcgttgagatcccaaatcaatttacatgggtaaag
agtatagatgcattcccatctgattcggacgctgttctgaactttttcaatgatgccctt
caagtaaaatgcgagggcataatggttaaagttctggatgataagccagttgaccgcctg
ttgcaggcagaagataccgccacagctcttggtgatggtgaattactacctcccgaagag
gataaaaaacaagagtctacggatactgctgagaagcagcgagggaacaggaaacggccg
ctgctgtcaacatacgagcctgacaaacgcctcgaatcttggcttaaagtgaagaaggat
tatagtgcttcttcggagaccttagacttgattcccattgcggcatggcatggccaaggt
cgaaaggccaaatggtggtctccaatacttcttgctgtgcgaaatcctgaaaccggctct
ctcgaggcagttaccaagtgtatgtccggtttcactgataagttttatgaagcgaataag
gagaagtatgcggaaggcagcgacaatataatctcacggccaagctacgtggagtactgt
ggcgagccggaggtttggtttcaacctcaggaggtgtgggagatggcctttgcagatatc
acgctgagtcctacgtatactgcagccataggcctggttagtgatgaacgcgggctgagc
cttcgattcccaaggttcttgagagtgagagaggacaagagcattgatgaagctagcaca
tccgactatcttgcccatctttgggacaagcaggcggagagagcaaaggtggcggagcct
cgagctggggattga

DBGET integrated database retrieval system