KEGG   Arthroderma benhamiae: ARB_05747Help
Entry
ARB_05747         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K18669  
dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
abe  Arthroderma benhamiae
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:abe00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    ARB_05747
Enzymes [BR:abe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     ARB_05747
Protein kinases [BR:abe01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   ARB_05747
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1344 aa AA seqDB search
MRIFVLFIAQRHTTIRTPRTNLKRRSRMWFVFCCQDKIYVYRILILIKIGNHTPPESSEF
LPAINFDDFHNSISSREPSLSHFPMPGQLVAGIGSAPSPPKSTTRWSTTTTSASGPKPAR
PNTLNRRQSNAQKPDLEGVGTVSSTAGPRQPRKSIGPGASVTSQANGDDGPPRRRQSFAK
RNATGEIRVNTNVNRGNHQPTEQPSGPSFLNTTRSQKAKSLQPVSRGNRENQITPGGSDH
SRSSSNTAIQTPGKGTVALNTTPSSKRSSMMPHHPTGLGARTISPTDARRMKRMSLVPNP
PPIPQRSPTQLELTSPRPRSSAPSPSMIPRKSVTPSSARTTPDPHRKSYSSGVSLSSNTT
YNSARNSSGSLQGRLSQTISTSRLPTPKPRTEHSNQEEEEVPPVPAIPKAYESPKNEAHL
SQTFTPRQTSMPFELEARRQAPKDIPSATEVEAPSTPAHQTSLGDTMMQHDNRAFSSEFK
PRATVTHGKRSLQPLKLPPLNLMPLSAPVASKINALRDKEPKDPTPNQSTTPPPPPRQTV
AKTPSTPMTASKTSFSHVPQEHTPMPAHTSRSNSSQFILPYQTGYRSQNSSSALDFMGLS
SNRTISPYISSSLPRGTDEMNSMRDKVVSKPSTNKLTGPRPQTQFSTISASESFNFKYEP
DTIEPNPSPTVVPPSPQRKISLDQTRHTGCNDTGTADNAKFENMPPPKLPASASVNNLSR
TSPASNTNFAPAKRKQSISNVVASISSRRNKSITGEPGPTVVTQSSTEIVDEAQPNKSSS
SSSLLNPVQRLLGGPRPPPAPASAKPRVEEGELDRDDLIAEEEMRKLGSKRKDFESAARE
LDELRRRAGPKERASPAQALKIASLNIFERGEIIDYKDIYFCGTHKAKKHVGDLNAQTAN
FGYDDERGDYNIVIGDHIAYRYEVVDVLGKGSFGQVVRCVDHKTGTLVAVKIIRNKKRFH
QQALVEVNILQKLKEWDPQNRHSVVNFTQSFYFRGHLCISTELLGINLYEFIKAHDFRGF
SLKIIRRFTKQMLMSLVLLQNHKVVHCDMKPENVLLVHPLRGDIKVIDFGSSCFENEKVY
TYIQSRFYRSPEVILGMSYGMPIDMWSLGCILAELYTGYPLFPGENEQEQLACIMEIFGP
PEKHLIEKSTRKKLFFDSSGKPRLTVSSKGRRRKPSSTDLRQALKCDNPAFLDFIARCLR
WDPARRMTPRDAMQHEFITGIRAPPRSTRSLHHSHSQSPVKRFASTSATLNGRPLPNPPS
TASSSDGTRLRDSSTNSPVKHGLPKRHSTFHHTSTTTTANPGATPKRASNIPPSGGSALP
RVTPRNASGKPDLAAAAATTSLVS
NT seq 4035 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattttcgttcttttcatagcacaacgacacactaccattcgaactcccagaaca
aatctgaaacgccgttcccgaatgtggttcgtcttctgctgccaagacaaaatatatgtt
tacagaatactaattttgataaagattggcaaccatacgcccccagagagcagtgaattc
cttccagcaataaatttcgatgatttccataacagtatctcctcaagagaaccgagtctt
agccacttccctatgccaggtcaacttgtagctggcattggatctgctccatctcccccc
aaatcaacaacgcgttggtcgactacaaccacttccgcctctggccctaaacctgctcgg
ccaaataccctcaacagaagacaaagcaatgctcagaagcccgaccttgaaggtgttggt
acagtctcctccactgcaggccctaggcaaccccggaaatctattggacctggtgcttca
gttacgtctcaagcaaacggtgacgatggccctcctcgaaggcgtcagagctttgcaaag
agaaatgcaacaggggaaatacgggtgaataccaatgtaaatcgtggtaatcatcaacct
acggaacaacccagtggcccttcttttctaaacacaactaggagccagaaagcaaaatcc
ctgcagcctgttagccgtggaaacagagagaaccaaatcacccctggcggctccgatcat
tctcggtcttcgtcaaatactgccatccagactccggggaaaggaaccgtggcattaaac
acgactccgtcgtcgaaacggtcttcaatgatgccacaccacccaactggcctaggcgca
agaacaatttctcccacagatgctcgaaggatgaagcgaatgtctcttgttcctaatccg
cctccgatcccacagcgctcgcctacccaactagagttaacctctcctcgcccacgttcc
tcagcaccatctccttctatgatacctcggaaaagcgtaacaccctcatcggcacgtact
acaccagaccctcaccgaaaatcttatagctcaggagtatccctctcatcaaatacaact
tataactctgctaggaattccagtggctctctacagggtcggctttcacagactatatca
acttctagacttccaactccgaaaccacggacagagcattcaaatcaggaagaagaggaa
gttccacctgttcctgcaatcccaaaggcgtacgaatcacccaaaaacgaagctcaccta
tcccaaacttttaccccaagacagaccagcatgcccttcgaactcgaagcgaggagacaa
gcgccaaaagacataccttctgccacggaagttgaagcgccatctacacctgctcatcaa
acttccctaggggacaccatgatgcaacatgacaaccgtgcctttagttctgaatttaaa
ccacgagccactgtcactcatgggaagagaagccttcaaccactgaaactaccgccactc
aatttaatgcctttgagcgctcctgttgcgagtaaaattaatgccctacgagataaggag
ccaaaggaccctactcctaaccagtctactacacctcctcctcctcctcgccaaactgtg
gcaaagaccccaagcactcctatgacagcctctaaaactagcttttctcatgttccccag
gaacatacgccaatgcccgcccacacgtctagaagcaacagttcgcagtttattctacct
tatcaaaccggctaccgttctcaaaacagttcaagcgctctggacttcatgggattatct
tctaaccgaactatttcgccatatatatcttcatcattgcctcgaggtactgatgaaatg
aactctatgcgtgacaaagtggtttccaagccttctaccaacaaattgactggcccacgc
ccacaaacccagttctctacaatttctgcctccgagtctttcaacttcaaatatgaacca
gatactatagaacctaatcctagccctaccgttgtaccgccctcaccgcaaagaaagata
agcctcgaccaaactagacacactggatgcaatgatacaggaacggcagataatgccaaa
tttgagaatatgccccctcccaaactgcccgcctcagcctccgtcaataatctatcacga
accagccctgcatcaaatacgaattttgcgccggccaagcgaaaacaatctatctcaaat
gtggttgccagcatttcttcacgaaggaacaagagtataacaggcgagccagggccgaca
gttgtgacccagtcatctacggaaatagttgatgaggcgcaaccgaacaaaagttcttca
tcatcctcacttctgaaccctgtacaacggctacttggagggccgcgcccgccccccgcc
ccagcatctgcaaagcctcgagttgaggaaggagaacttgaccgtgatgacctcatagct
gaagaggaaatgcggaagcttggaagcaagcgaaaagattttgagtcggcagcaagggaa
ttggatgaacttcggcgaagagctggtcctaaggaacgggcttctccagctcaagcccta
aagattgcaagtcttaatatctttgaacgaggagaaattattgactataaggacatctac
ttctgcggtactcacaaagccaagaagcatgtcggcgatcttaatgctcagaccgccaat
tttggctatgatgatgaacgtggagactataacatagttatcggcgatcatattgcttat
cgatatgaagttgtcgatgtccttgggaaaggcagcttcggtcaagtcgtacgttgcgtt
gatcacaagactggcacccttgttgccgtcaagattattcgtaacaaaaaacgtttccat
caacaggcactagttgaggtgaatattcttcaaaaactgaaagaatgggatccacaaaac
cgccacagtgttgtcaacttcacgcaaagtttttatttccgtggacacctctgcatatct
acggagctactgggtatcaatctttatgagtttatcaaggctcatgatttccgaggattc
tccctcaaaattattcgtcgtttcactaaacagatgttaatgtctctggtgctccttcaa
aatcacaaagttgtgcattgtgacatgaaacccgaaaatgtacttctcgtacatccgctc
cgtggagatattaaggtcattgactttggatcaagttgctttgagaatgaaaaggtgtat
acatatatccagagtcgtttctaccgctccccagaagttattcttggcatgtcgtacgga
atgccaattgacatgtggtctcttggctgcattctcgcggagctatatactgggtatcca
ctgtttcccggcgagaacgagcaagagcagttggcctgtatcatggaaatattcggaccc
cctgagaagcaccttatcgagaagagtactaggaagaaactgttcttcgactcctctgga
aaacctcgtttgactgtctcgtcaaaggggcgccggcgcaaacctagctcaactgatctt
cgacaggctcttaaatgtgataatcctgcgttcctagatttcattgctcgctgcttgaga
tgggaccctgctcgcagaatgacaccgcgcgatgctatgcaacatgaattcattactggt
attagagctcccccccgctccacccgctctctgcaccattcgcattcccagtcacccgtc
aaacgatttgcatctaccagtgctacattaaatggtcggccccttccaaaccctccttcc
acagcttcaagcagcgacggaacacgtcttcgggactcctcaaccaattctcccgttaag
catggcttacccaagcgccactctaccttccaccacacatccacaacgacgacggccaat
ccgggggcgaccccaaagcgggcgtcaaacatccctccgtcaggtggctccgctttgcct
cgtgtgacgccgaggaatgctagcgggaagccagaccttgcagccgcggcagcaacaacc
agcttggtaagctga

DBGET integrated database retrieval system