KEGG   Arthroderma benhamiae: ARB_05777Help
Entry
ARB_05777         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
abe  Arthroderma benhamiae
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:abe00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism [PATH:abe00232]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 305 aa AA seqDB search
MASRLAAARYGKENVRVYKVQRDEAAGTQTVVEMTVRCLLEGDIDVSYTKADNSVVVATD
SIKNTIYILAKQNPVTPPELFASIVGDHFTQKYSHIRVAHVNVVAQRWSRMNIKGKPHPH
SFLKDASEVRSTDVTVTKGKGIDIRTSLSGLSVLKSTNSQFHGFVRDEFTTLPETWDRIL
STDVDSAWTWSTFSNLEQVHGSAAKFDSTWEVSRGIILDIFSSDNSASVQNTMYKMGEQI
LAAQPLLETAELSLPNKHYFQLDLGWHKGLKNTGKDAEVYLPGSGASGLIKCTVGREAVK
DKSKL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaggttagccgcagctcgctatggcaaggagaacgttcgtgtgtacaaggta
cagcgggacgaggctgcagggactcagacggtggtcgagatgaccgtccgctgcctgctc
gagggtgatatcgatgtctcgtacaccaaggcagacaacagcgtcgtggtagcgacggac
tcgataaagaataccatctatatcctggcaaagcagaatccagtgacgccgccggagctc
tttgcttcaatcgtgggagaccatttcacgcagaagtacagccatatccgtgtagcgcat
gtcaacgtagtggcacagcggtggtcccggatgaatatcaagggcaaaccacatccgcat
tccttcctcaaggacgcctcggaggtccggtctacagacgtcaccgttaccaagggcaag
gggatcgatatcaggacgtctttgtctggcctctctgtcttgaagagcaccaattcgcag
tttcatggcttcgtgagagacgagttcactactctacctgaaacctgggaccgaatcctt
agcacagacgtcgattcggcatggacatggtcaacattctcaaacctggagcaagtgcat
ggttcggctgccaagtttgactctacctgggaagtctcgcgcggcatcatactggatatc
ttcagcagtgacaacagtgcgagcgtccagaataccatgtataagatgggagagcagata
ctcgctgcccagccgctcctggagacagccgagctcagcctgcccaataagcattatttc
cagcttgatctgggctggcataagggcttgaagaacactggcaaagacgctgaagtttac
ctgccgggctctggcgccagcggcctcatcaaatgcacagttggacgagaagctgtcaaa
gataagtcaaagctgtaa

DBGET integrated database retrieval system