KEGG   Arthroderma benhamiae: ARB_05777Help
Entry
ARB_05777         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
abe  Arthroderma benhamiae
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ARB_05777
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    ARB_05777
Enzymes [BR:abe01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     ARB_05777
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 305 aa AA seqDB search
MASRLAAARYGKENVRVYKVQRDEAAGTQTVVEMTVRCLLEGDIDVSYTKADNSVVVATD
SIKNTIYILAKQNPVTPPELFASIVGDHFTQKYSHIRVAHVNVVAQRWSRMNIKGKPHPH
SFLKDASEVRSTDVTVTKGKGIDIRTSLSGLSVLKSTNSQFHGFVRDEFTTLPETWDRIL
STDVDSAWTWSTFSNLEQVHGSAAKFDSTWEVSRGIILDIFSSDNSASVQNTMYKMGEQI
LAAQPLLETAELSLPNKHYFQLDLGWHKGLKNTGKDAEVYLPGSGASGLIKCTVGREAVK
DKSKL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaggttagccgcagctcgctatggcaaggagaacgttcgtgtgtacaaggta
cagcgggacgaggctgcagggactcagacggtggtcgagatgaccgtccgctgcctgctc
gagggtgatatcgatgtctcgtacaccaaggcagacaacagcgtcgtggtagcgacggac
tcgataaagaataccatctatatcctggcaaagcagaatccagtgacgccgccggagctc
tttgcttcaatcgtgggagaccatttcacgcagaagtacagccatatccgtgtagcgcat
gtcaacgtagtggcacagcggtggtcccggatgaatatcaagggcaaaccacatccgcat
tccttcctcaaggacgcctcggaggtccggtctacagacgtcaccgttaccaagggcaag
gggatcgatatcaggacgtctttgtctggcctctctgtcttgaagagcaccaattcgcag
tttcatggcttcgtgagagacgagttcactactctacctgaaacctgggaccgaatcctt
agcacagacgtcgattcggcatggacatggtcaacattctcaaacctggagcaagtgcat
ggttcggctgccaagtttgactctacctgggaagtctcgcgcggcatcatactggatatc
ttcagcagtgacaacagtgcgagcgtccagaataccatgtataagatgggagagcagata
ctcgctgcccagccgctcctggagacagccgagctcagcctgcccaataagcattatttc
cagcttgatctgggctggcataagggcttgaagaacactggcaaagacgctgaagtttac
ctgccgggctctggcgccagcggcctcatcaaatgcacagttggacgagaagctgtcaaa
gataagtcaaagctgtaa

DBGET integrated database retrieval system