KEGG   Trichophyton benhamiae: ARB_05798Help
Entry
ARB_05798         CDS       T01611                                 

Definition
(RefSeq) hypothetical protein
  KO
K07203  
serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
abe  Trichophyton benhamiae
Pathway
Mitophagy - yeast
Brite
KEGG Orthology (KO) [BR:abe00001]
 Cellular Processes
  Transport and catabolism
   04139 Mitophagy - yeast
    ARB_05798
Enzymes [BR:abe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     ARB_05798
Protein kinases [BR:abe01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   ARB_05798
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 2374 aa AA seqDB search
MAQVTPAADTTQRLFQELKSKNEDTRNRAATELHENIIAASRELPQDKFLDHYNSINQRI
AQLIVTGNDANEKIGGLLMLDRLIEFDGVDTAQKTTRFASYLRSALRSNDNSVLLFAAGC
LGHLAKPGGALTAELVESEIQSALEWLQTERQESRRFAAVLVIQELAKGSPTLLYGFIPQ
VFDLIWVALRDPKVVIRETAADAVSECFEIIAARDSAVRSQWFSRVYEESLQGLRSNNVD
WIHGSLLTLKELLLKGAMFMNEHYHNTCEIVLRLKDHRDPKIRAQIVLTIPVLASYAPLE
FTNTYLHKFMIYLQAQLKRDKERNTAFIAIGKIASAVGHAIGQFLDGIIVYIREGLALKA
RNRAAVNEGPMFECISMLSLAVGQTLSKYMESLLDPIFACGLSKSLTQALVDMAHYIPPI
RATIQEKLLDMLSIVLCGTPFRPLGCPESRLPPIPSFAKDFGSLPQDRSDSEIALALHTL
GSFDFSGHVLNEFVRDVAIKFVDSDSPEIRKASALTCCQLFVHDPIINQTSAHSIQVVSE
VIDKLLSVGVGDPDPDIRRNVLFSLDKKFDRHLAKPENVRCLFLAVNDEMFPVREAAISI
IGRLSSVNPAYVFPPLRKLLVNLLTGLSFATNSRQKEESAQLISLFVSNATKLIRSYVDP
IVTTLLPKTSDGNPAVEATTLKAIGELATIGGEDMKQYLPQLMPIILDSLQDLSSQAKRE
AALKTLGQLASNAGYVIEPYKEYPQLLSILINIIKTEQTGSLRKETIKLIGILGALDPYK
DQQISETSPDVHYVNEVQTVSDVSLIMQGLTPSNEEYYPTVVINTLLQNILRESSLAQYH
SAVIDAIVTMFKTLGLKCVPFLGQIIPAFISVIRSTPVSRLETYFNQLAILVTIVKQHIR
AFLPEIIEVIRDYWGSPYPVQCTILSLVEAVAKSLEGEFKKYLAALVPLMLDTVEKDNSV
RRQPTERILHTFLIFGSSAEEYMHRIVPAIVKIFDKTQNPSNIRKCAMETLAKLSRQVNV
SDFASLMIHPLSRVINNAEKPLRQTALDCICTLIFQLGQDFNNYVPLINKVLKFNQIHHH
SYHILVSKLQKGDPLPQDLNPNEHHSNLVEDSAFADVGQKKIFVNQQHLKNAWDATQKST
REDWQEWIRRFSVELLKESPSHALRACASLAGIYQPLAKDLFNAAFVSCWTELYHQYQEE
LVHSIDLALTSQNIPPEILQILLNLAEFMEHDDKALPIDIRTLGKYAGKCHAFAKALHYK
ELEFEQDQNSGAVEALISINNHLQQSDAAIGILRKAQAYRDVELKETWFVKLQRWEEALA
AYKRRELIDPDSFEVTMGKMRCLHALGEWKMLSDLAQEKWNQASNEHRKAIAPLAAAAAW
GRGQWELMDSYIGVMKEQSPDRSFFGAILSLHRNQFEEASALIEKARNGLDTELSALLGE
SYNRAYNVVVRVQMLAELEEIITYKRSVDDPEKQEAMRLTWNKRLLGCQQNVEVWQRMLK
VRALVITPRENLDMWIKFVNLCRKSNRMGLAERSLSALESIEAADGGIPPEVTYARLKFE
WASGRQAEALKALEEFTISLTESYGRYNSILSAQDEHTPTDGPALTNGINDSNHTNAGYS
KQHLGDANNIRRLLAKSHLKQGEWQTVLQRGDWRSDGVRDVLNSYSAATQYNRDSYKAWH
AWALANFEVVNSLTAQPEREPPHHIILEHVMPAIRGFFRSIALLPSSTLQDALRLLTLWF
THGGDAEVNAAVVEGFSTVSIDTWLEVTPQLIARINQPNPKVRTAVHRLLAELGKAHPQA
LVYPLTVATKSNVVRRSQSAMTIMDSMRAHSSRLVEQAEVVSGELVRVAVLWHELWYEAL
EEASRLFFTDHDVEGMLSTLAPLHDMLDKGAETLREVSFAQAFGRDLAEAKHFCNLYRET
GEMGDLNQAWDLYYNVFRKISRQVTQIKSLDLKYISPKLKDVVDLDLAIPGTYQSGRPVI
RIQSFDSVAIVVQTKKKPRKMIIRGSDGNSYMYALKGHEDIRQDERVMQLFGLVNTLLDN
DSECFKRHLTIQRFPAIPLSQNSGLIGWCCNTDTLHALIKEYRESRRILLNIEHRIMLQM
APDYDNLTLMQKVEVFGYAMDNTTGKDLYRVLWLKSKSSESWLERRTNYTRSLGVMSMVG
YILGLGDRHPSNLLLDRITGKIVHIDFGDCFEIAMHREKYPERVPFRLTRMLTFAMEVSN
IEGSFHITCEAVMRVIRENKESLMAVLEAFIHDPLINWRLGARESPARLSILDRHPPTES
NMDNPIQPTTFSRRRPSILDGGILDAQQGIPNEGREVQNARALQVLGRVKEKLTGRDFRT
PDELNVSDQVDKLLVQATSVENLCQHYIGWCSFW
NT seq 7125 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaagttaccccagctgcagatacgacccagcgactctttcaggagctcaaatcc
aagaacgaggatactcggaatagagctgccaccgagcttcacgaaaatattatagcagct
tctcgagagctgccccaagataaatttctcgaccactacaactccataaaccaacgtatc
gcccagcttatcgttaccggaaatgacgcgaacgaaaaaatcggtgggctacttatgctc
gaccggttaatcgagttcgatggtgtggatacagcacagaaaacgactcgatttgctagc
tatctgcgaagtgctttgaggagcaatgataactcagtattgctctttgcggcgggctgt
ctcgggcatttggcgaaacccggtggtgctttaactgcagagctagttgaaagtgagatc
cagtcagctctagaatggctacagaccgaaaggcaggagagcaggcgcttcgcggcagtc
ctggtcattcaagaacttgcaaagggctctccaactttgctgtacgggtttatcccgcaa
gtctttgatcttatttgggtcgctctacgtgatcccaaagtggtcattcgagaaactgcc
gccgatgccgttagtgagtgttttgaaataatagcggccagagatagcgcagttcgttct
cagtggttttcgagagtatacgaggagtctttgcaaggcctacgatcgaacaatgtggac
tggatccatgggtcacttcttacgttgaaggagctacttctcaagggtgccatgtttatg
aacgaacattaccataacacttgtgaaatagtgctgcgattaaaagaccaccgggacccc
aagattcgtgctcagattgtgcttaccataccagttctcgcctcttacgcccccctcgag
ttcaccaatacataccttcataaattcatgatataccttcaagcacagctaaaacgagac
aaggaaaggaatactgctttcatcgccataggaaagattgcaagtgctgttggccacgcc
atcggtcagttccttgatggaatcatcgtatatatccgcgaaggactggccttgaaagcc
cgaaatcgcgccgctgttaatgaaggcccgatgtttgaatgcattagtatgctgtctctt
gcggttggtcaaactcttagcaaatacatggagtcacttctcgaccctatttttgcctgt
ggcttgagtaaatcccttacccaggctcttgtcgatatggcacactacatcccacctatc
agagctactatccaagaaaagctgctggacatgcttagcattgttttatgtggaacgcct
tttaggccattgggatgcccggaaagccgattaccccctataccttcctttgccaaggac
tttggctccttacctcaggatcgtagtgatagcgagatagccctcgcacttcatacactt
ggcagctttgatttctctggtcatgtccttaatgaattcgttcgcgatgtggccatcaaa
tttgttgacagcgatagccctgagatcagaaaagcatctgctttaacttgttgccaactt
ttcgttcatgaccctatcattaaccagacaagtgctcactcgatacaggtcgttagcgag
gttattgataaactactctcagttggagtcggcgaccccgatcctgatatccggcgaaat
gtgttattctctctggataagaaatttgaccgtcacttggcgaaaccagaaaacgttcga
tgtttattcctagctgttaatgatgagatgttcccggtacgagaagcagccatcagcatc
attggccgcctctcgagcgtcaacccggcctatgttttcccgcctctgaggaaactactt
gtgaatcttctgactggcctaagctttgctacaaactcccggcaaaaggaagaaagtgcc
caattaatcagcctcttcgtttcaaatgctaccaaactcattcgctcctatgttgacccc
attgttacaacgctattgcccaagacttcagacgggaatcccgcggtagaagcgaccact
ctcaaagccattggagagcttgcgacaattggtggtgaagacatgaaacaatatcttcct
caacttatgccaataatcctggattcactacaagacctttcctctcaggctaagagagag
gctgccttgaaaactttgggtcagttggcaagtaacgcaggttatgtcattgaaccttat
aaagagtatccgcagcttctttctattctcatcaacattattaagacggagcaaacgggc
agtctaaggaaagagaccatcaaactaattggaatactgggagcgcttgacccttacaaa
gatcagcaaattagtgaaacttctcctgacgttcattatgtcaacgaagttcagactgtt
tccgatgtttctcttattatgcaaggccttactccttccaacgaggagtactaccccacc
gtggtcatcaatactttactccaaaacattctgcgagagagctctcttgcccaataccat
tctgctgtgattgacgccattgttacgatgttcaaaacccttgggctcaaatgtgtccca
tttctaggccagataatacctgcatttatatcggtcatcagaagcacgccggtcagccga
cttgaaacgtatttcaaccagttggcaatcttggtaacgatcgtcaaacaacatatccgt
gcattcctccccgaaattatcgaagtcattcgtgactattggggatctccatatcccgta
caatgcacgatactatctctagtggaagctgttgctaagtcattagaaggcgagttcaaa
aagtacttggccgcccttgttccgttgatgctggatactgttgaaaaggacaattctgtc
cgccgccaacccacagagaggatccttcacactttcctgatcttcggctcaagtgctgaa
gagtatatgcatcgcattgttcccgccattgtcaaaatcttcgataagactcaaaatcct
tccaacatccgaaaatgcgccatggaaactctggcaaaactctctcgacaggttaacgta
tcagactttgcatctcttatgatacatccgctctcaagagttataaacaacgccgagaaa
ccactcaggcaaactgctttggactgcatttgcactcttatcttccagcttgggcaggat
ttcaataactacgttccactcatcaacaaagttctcaagtttaatcaaatacaccaccac
agttatcatattcttgtttccaagctacagaaaggggatccattaccccaggaccttaat
cccaatgaacaccatagcaatcttgtggaggattcagcatttgcggatgttggccagaag
aagatattcgttaaccaacaacatctcaaaaatgcatgggacgccacacagaagtcaact
cgagaagattggcaggaatggattcggcgcttcagcgtcgaactactcaaagaatccccc
tcccatgcccttcgtgcctgtgctagcttggctggtatctatcagccgcttgctaaggat
cttttcaacgctgccttcgtttcctgctggacggaactttaccatcagtaccaggaggaa
ttggttcactccatcgacttggcacttacttcccagaatatccctcctgaaatcctacaa
atacttctcaacttagctgaattcatggaacatgacgacaaagctctaccaattgatatc
cggactctcgggaaatatgccggtaaatgtcatgcattcgcaaaagcattacattataaa
gaactggagttcgagcaagaccaaaattctggagcagtggaggcattgattagcatcaac
aatcatcttcaacagtctgatgccgcaattggtattctccgcaaggcccaggcgtatcga
gatgtcgagctaaaggagacatggttcgtgaaactccagcgatgggaggaagcattagct
gcttataagagacgggagttaatcgaccctgattctttcgaagttaccatgggtaagatg
cgatgtcttcacgctcttggcgaatggaaaatgctttcagaccttgcgcaggagaaatgg
aatcaagcatcgaatgagcaccgcaaggccatcgccccactcgctgctgctgctgcatgg
ggaagaggccaatgggagcttatggattcatacattggggtgatgaaggagcagtcgcct
gatagatcgttcttcggagcaattctctcacttcatcgcaaccagtttgaagaagcgtcg
gctctgatagaaaaggccagaaatggcctagacactgagctctctgcattgctaggtgaa
tcatacaacagagcttacaatgttgttgtccgggtgcaaatgctcgctgagctggaagaa
atcattacttataaaagaagtgtggatgacccagaaaagcaagaggcaatgagattgacg
tggaataaacgacttctgggttgccagcagaatgttgaggtatggcagcgtatgctcaaa
gtcagggcacttgttatcactccccgtgaaaatcttgatatgtggatcaagttcgtcaat
ctatgccgcaaatcgaaccgtatgggacttgcagaacgttctcttagtgccttagagtct
attgaggctgcagatggtggtatcccaccagaagtgacctatgcacgccttaaatttgag
tgggcatctggccgacaggctgaagctctcaaagccctggaggaatttactatctctctt
acagaatcgtatgggcggtataattcgattctttctgcgcaagacgagcatacgcctact
gacgggccagccctcaccaacggtataaatgattccaaccatactaatgctggatattca
aaacaacatctcggtgatgccaataatatccgacgtcttcttgcaaagagccatcttaaa
cagggagaatggcaaacggtgttacaacgcggtgattggagatcagatggtgtccgtgat
gttctaaactcgtattctgcggctacacaatataaccgcgactcgtacaaagcgtggcat
gcctgggctctcgcgaacttcgaagtggtaaactccctaacggctcagccagagagggag
cctcctcatcacatcatcctcgaacatgtcatgcctgcaatacgtggatttttccggtca
atcgcactcctaccatcaagcacattgcaagatgcgcttaggctgctgacactttggttc
acccatggtggcgatgctgaagtcaacgctgccgtcgtggaaggcttctcaactgtgagc
atcgatacctggcttgaagttactcctcaactcattgcccgcatcaatcaacccaatcct
aaggtacgcactgctgtacatcgattattggctgagctgggcaaagctcacccccaagcg
ctggtttaccccttaactgtcgcaactaaatccaacgtggtgcgccgttcccagtctgcc
atgaccatcatggacagcatgagggcgcatagctcacgattggttgaacaagctgaagtt
gtcagtggtgagctagtgcgtgtggcagtattatggcacgaactatggtatgaggcattg
gaggaggcctctcggctcttctttaccgaccacgatgtggaaggtatgttgtccactctt
gcgcctctccacgacatgctcgataagggtgcagagaccttaagagaggtatcttttgct
caggcttttgggagagacttagccgaagccaaacacttctgcaacttgtaccgggaaact
ggagaaatgggcgatctcaaccaagcttgggatctctactacaatgtgttccgcaagatc
tcccgacaagtaacgcaaatcaaatcgcttgatctaaaatacatttcacccaagctcaag
gacgttgtcgatcttgacttggctatacctggcacataccaaagtggacgacccgttatc
cgaatacaaagctttgacagtgttgctattgttgtgcagactaagaagaaacccagaaag
atgatcatcaggggaagtgacggaaactcatacatgtatgcgctcaagggtcatgaagat
attcgacaagatgaacgtgttatgcaattgtttggtctagtcaacactctcttagacaac
gatagcgagtgtttcaaacgtcacttaacgattcaacggttccctgccattcccctgtca
caaaattctggtttaataggatggtgctgcaataccgacacgcttcacgctctcatcaaa
gagtaccgtgagagccgtcgcattctgcttaatattgaacaccgaattatgctccagatg
gctcctgattatgacaatctgactctcatgcagaaagtggaagtgtttggttacgcgatg
gacaataccactggaaaagatctttaccgagtcctatggttgaaaagtaaaagctccgag
tcgtggctcgaacgacgaacgaattatacccgatctctcggagttatgtcaatggttggg
tatatccttggcttaggtgaccgtcatccgtcgaacttgctgcttgataggattacagga
aagatagttcacattgattttggcgactgcttcgagatcgcgatgcatcgtgagaagtat
ccagaacgggtaccattcagactaacccgtatgcttacatttgccatggaagtcagcaat
atcgagggtagtttccacattacttgtgaggcggtcatgcgtgttattcgcgaaaacaaa
gagtctcttatggccgttcttgaagctttcattcacgaccctttaatcaactggcgtcta
ggagcacgggaatctcccgcccgcctttcaatcctggataggcacccgcccacagagtct
aacatggataaccccatccagccgactaccttctcccgccgccgcccatcaatacttgat
ggtggcattcttgatgctcaacaaggcatccccaacgaaggacgtgaagtgcagaatgcg
cgagcccttcaagtacttggaagagtcaaggagaagttgactggccgcgacttcagaacg
cctgatgaactcaatgttagcgaccaggtcgacaaacttctagtccaagccacaagtgta
gaaaacttgtgtcagcattacatcggttggtgcagtttttggtaa

DBGET integrated database retrieval system