KEGG   Trichophyton benhamiae: ARB_05882Help
Entry
ARB_05882         CDS       T01611                                 

Definition
(RefSeq) hypothetical protein
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
abe  Trichophyton benhamiae
Brite
Enzymes [BR:abe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     ARB_05882
Transcription machinery [BR:abe03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     ARB_05882
Chromosome [BR:abe03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    ARB_05882
   HAT complexes
    PCAF complex
     ARB_05882
    STAGA complex
     ARB_05882
    TFTC complex
     ARB_05882
    SAGA complex
     ARB_05882
    SLIK complex
     ARB_05882
    ADA-HAT complex
     ARB_05882
    HAT-A2 complex
     ARB_05882
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 429 aa AA seqDB search
MDKTELEQPCPAESEQNHKRPAPEELSIAPDAKRNKAIDGGPTVPDLSISTIAQRVPPPP
NPASLKYRICANNIVKPAVLEEQRGEIEYRVVNNDGSRESTIILTGLKCLFQKQLPEMPK
AYIARLVYDRAHVSLALVKMPLEVIGGISYREFRARKFAEIVFCAISAKHQVKGYGAHLM
AHLKDYIRATSPVMHFLTYADNLAIGYFQKQGFTKDITLEESVWMGYIKDYEGGTLMQCT
LLPRMRYLEAGRMLLKQKECVQAKIRTFNTSDVVHQPPEQWANSHGNIAPIDPLSIPAIR
ATGWSPDMDELSRMLPRRGPYFKELRHFLTLMRNHKSAWPFVHPVNKNEVPDYYNIIKSP
MDLSTMEERLEHGCYTTPKVLFDDLKLIFSNCRKYNSEYSIFVKCARQLERYMRKIVKEI
PEWQKFLEE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaacagagttggagcaaccatgtccagctgagagcgagcagaatcacaagcgg
ccggctcccgaagaactttctatcgcccctgacgccaaaagaaacaaagctattgatggg
gggccgacagtgccggatctcagcatttctactattgctcaacgggttcctccccccccc
aacccggcatctcttaagtacagaatatgtgctaacaacattgtcaagcctgcggttctg
gaagaacagagaggcgagatagagtaccgggtagtcaacaatgacggttccagagaaagt
acaattattctcacgggacttaaatgcctattccaaaaacaactcccagaaatgcctaaa
gcttatatcgcacgtctcgtttacgaccgtgctcatgtgtctctagcccttgttaagatg
ccccttgaggttattggcggaatatcgtatcgggaattccgcgctcgcaagtttgccgaa
atagtgttttgtgcaatatccgctaagcatcaagtaaaaggatatggggcgcaccttatg
gcccatctgaaggattatatcagagctacctccccagtgatgcattttttaacttacgct
gataatcttgccattggctactttcagaaacagggtttcacaaaagatattactctcgaa
gagtctgtctggatggggtatatcaaagactacgaagggggaacgcttatgcaatgcacc
ttgcttccccgaatgaggtatcttgaagctggccgtatgctccttaagcagaaggagtgt
gtccaagccaagatacgtacctttaacaccagtgatgttgtccatcagccacctgagcag
tgggctaacagccacggtaacatcgccccaatcgatccactctctatccctgcaattcgt
gcaactggttggtctcctgacatggacgagttatcacggatgctgccacgccgcgggcct
tattttaaggagctccggcattttttaactcttatgcggaaccacaaaagcgcatggccc
tttgttcaccctgttaacaaaaatgaagtccccgattattacaacattattaaatcgccc
atggatctgtcgacgatggaagaacgattggagcatggttgctatactactccaaaggtc
ctttttgacgatcttaagctgattttcagtaactgtcgaaagtataatagtgaatactcg
atattcgttaaatgtgcacggcagctggaaaggtacatgcggaagatcgtcaaggaaatt
ccggagtggcagaagtttcttgaagaatag

DBGET integrated database retrieval system