KEGG   Trichophyton benhamiae: ARB_05914Help
Entry
ARB_05914         CDS       T01611                                 

Definition
(RefSeq) hypothetical protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
abe  Trichophyton benhamiae
Pathway
abe00010  Glycolysis / Gluconeogenesis
abe01100  Metabolic pathways
abe01110  Biosynthesis of secondary metabolites
abe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ARB_05914
Enzymes [BR:abe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     ARB_05914
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 9525884
NCBI-ProteinID: XP_003015603
UniProt: D4ANU7
AA seq 314 aa AA seqDB search
MERSKKPTAIPVSSSAPGPSVSVLENRVEASLATGESITVNLFGATVTSWKLADGSEQLF
LSEGAHLDGSKPIRGGIPLVFPSKVFGPPPKEHATSALPQHGFARNAYWEFLGKSTSETE
GDASVKLDFGLSKGMLSDKFQKDWPFEFGLVYSVTLSPRSLITSLQVQNKGTTSFEFQSL
LHTYFRVDDISKMCIAGLQSKSFVDKLRGASTFTEESDAITISSEVDRVYQSLDPATPVI
VTSSGKPVFSITREALTDMVVWNPWIEKAKGMADFTPDEAYKNMVCVEAGSVSGWQTLEP
GDMWEGGQTIRCRL
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggagcgttcaaagaagccgacagccatccccgtatcctcctccgcaccaggacccagc
gtctccgtcctcgagaaccgcgttgaagcatcgctggcaaccggagaatcgattactgtc
aacctgtttggagctacagtgacatcgtggaaactcgccgacgggtcagagcagcttttc
ctcagcgaaggagctcatctagacggctccaagcccatccgcggcggcatccccttagtc
ttcccaagcaaggtgtttggccctcctccaaaggaacatgcaacatctgcactgccgcag
catggcttcgcccgcaacgcctactgggaatttctaggcaaatccacctcggaaaccgaa
ggagatgccagtgtcaagcttgactttggcctgtcaaagggtatgctgagtgacaagttc
cagaaggactggccgttcgagtttggcctagtgtacagtgtcaccctaagcccccggagc
ttgatcacttcgctgcaggtccagaacaagggaacgacctcctttgagttccagtctctg
ctgcatacttacttcagagtagatgacatctcaaagatgtgcattgcaggtcttcagtcc
aagtcgtttgtcgacaaactccgcggtgcatccacgttcactgaagagtccgacgccatt
accatctcctccgaggtagaccgcgtctaccagtctcttgaccccgccacgcctgtcata
gtcacttcctcgggcaagccggtcttctccataacccgggaagcgttgacggacatggtc
gtctggaacccgtggatcgagaaggccaaggggatggccgatttcaccccggacgaagcc
tacaagaacatggtctgcgtcgaggcgggatctgtatctggatggcagactctggagcca
ggtgacatgtgggaaggagggcagacgattcggtgtcggctgtga

DBGET integrated database retrieval system