KEGG   Arthroderma benhamiae: ARB_05919Help
Entry
ARB_05919         CDS       T01611                                 

Definition
lysophospholipase Plb2
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
abe  Arthroderma benhamiae
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ARB_05919
Enzymes [BR:abe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     ARB_05919
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 643 aa AA seqDB search
MMFIPATLGTFVLASLLPATVGAGIPNAAADVAVRALPNAPDGYAPAEVDCPSTKPAVRS
AAKLSQQEQDWLKKRRMKTTGAMADFFSRVKIEGFDAVAYLVGNADNVAKLPNVAIAVSG
GGYRALMNGAGALKAFDSRTDNSTEPGQLGGLLQSATYLSGLSGGGWLLGSMYVNNDSTI
TELQKGGSNSLWKFNRSILEGPDDGSSGVVDTAEYYKEMIKEISRKKAAGFETSITDIWG
RALSYQLINAPKGGPAYTWSSISQNSKFQSGDVPFPLLVADGRNPGEKLIGGNATIFEFN
PYEFGTWDPTIFGFVPTQYIGSKFEAGTLPSDEKCVRGMDNAGFIMGTSSSLFNQFALHL
DSQDLPKVVKDSLRDFLSSLDEANNDIAEYKPNPFFGYAKSTSPFAGVKSLPVVDGGEDK
QNIPFHPLIQPARHVDVIFAIDSSADTELAWPNGDSIIATYQRSLNSTGIANGTSFPAIP
DNNTFINLGLNHNPTFFGCDSSNTTNPTPLIVYIPNSPYVTHSNVSTFNLKYNTTQRDAI
ILNGYNVATMANATRDGNWPTCVGCAMLSRSLERTKTAVPDACKQCFKMYCWDGTLNSTK
PDVYDPKLFLTEVDLQSAAKGLHASGKLSLVAAVVTLLSILLV
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgatgttcatcccagcaacgctgggaacatttgtcctagcaagcttgcttcctgcgacc
gttggagccggcatacctaatgccgccgcagatgttgcagtcagagctctgccaaatgcg
ccagacggctatgcccctgcagaagtcgactgtccatctaccaaaccggctgttcgatcg
gctgcaaagctgtcgcagcaggaacaggactggctgaagaaaaggaggatgaagaccacg
ggcgctatggcagacttctttagtcgcgtgaagatcgaaggctttgacgccgtggcatac
ctcgtaggcaacgcagacaatgttgctaagctcccaaacgttgccattgccgtttcagga
ggcgggtaccgtgctctcatgaatggagctggtgccctcaaggcatttgatagtcggacg
gataattcgactgagcctggacagctgggtggcttgctgcagtcagctacttacctgtcc
ggtctcagtggtggtggatggctacttggctcaatgtacgtcaacaatgacagtactatc
acggaattgcaaaagggaggcagtaattcgctgtggaagtttaaccggtccattctcgag
ggaccagatgatggtagctctggggtcgttgacaccgctgagtactataaggagatgatc
aaggagatttctcgcaagaaagccgctggcttcgagacctctatcactgatatctggggc
agagcattgtcgtatcagctcattaacgctcccaagggtggtccggcctatacatggtcg
tccatctcacagaattccaagttccagagtggcgatgtgcccttccctcttctcgttgcc
gatggcaggaatccgggtgaaaaactcatcggcggtaatgctaccatcttcgaattcaat
ccatacgaatttggtacatgggatcccactatcttcggttttgttccaacacagtacatt
ggctccaagttcgaggctggaacccttccatcggatgagaagtgcgtccggggaatggac
aacgccggtttcatcatgggaacttcttcctctctattcaaccagttcgcgttgcacctt
gatagccaggacctgcccaaagtcgtcaaggacagtctccgtgacttcttgagctcgctt
gatgaagccaacaatgacattgccgagtacaagcccaacccattttttggatatgccaaa
agcacatctcctttcgcaggagtaaagtccctccccgttgttgatggcggtgaagacaag
cagaacattccattccatcccctgatccagccagctcgacatgttgacgttatatttgcg
attgactcttccgctgacaccgaactggcctggcctaatggcgacagcataatagctact
taccaacgcagtctgaacagcactggaatcgccaacggaacatccttcccagctatacca
gataataacactttcatcaatctcggcctgaaccacaatcccactttcttcggatgcgac
agctcaaataccactaatcctacgccgttgatcgtatacatccctaacagtccctacgtc
acacattcgaatgtctcaaccttcaacctgaagtacaacaccacacagcgtgatgctatc
attctcaatggatataacgtcgcaaccatggccaatgccactcgagatggcaactggcct
acctgcgtcggctgtgctatgctcagcaggtcccttgagcgaaccaagaccgcagtcccc
gatgcttgcaagcagtgttttaagatgtactgctgggatggaacgctcaatagcaccaag
ccagacgtctacgacccgaaactgttcttgacggaagtggacctacagagtgctgctaag
gggcttcatgcttcgggaaagctgagccttgtagcagcagtggtcacactgctttctata
ttactggtgtaa

DBGET integrated database retrieval system