KEGG   Arthroderma benhamiae: ARB_05984Help
Entry
ARB_05984         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
abe  Arthroderma benhamiae
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:abe00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1495 aa AA seqDB search
MATAVSPRQLELEQLSSSSSSSSSSSSCTPSCPQYPAHSQYTMADFAGTIFLFFVQVLPG
LLYSVITFTTITVPTALFTLFSMSLTFTMNFTTLLLITLFLVSTISWFVRYRFLNMYAHL
PPEPQRQEPQIDLFPDTQEGDSKPGLANYLDEFLSAIKVFGYLERPVFHELTRTMQTRKL
IAGETLLLEEEKGFCLVVDGLVQIFVKSARERGKDGESSVEDSMEEEEEQHHRHHQGYQL
LTEVKNGASMSSLFSILSLFSEDVKLRYQEGEEPASPSPVSPSPFASSPRSSFQDRHHHH
RDISLPSNGGRLPTVPPMTLDDTNSAAHFSTAHTPPTSSAQNRRTPKRPRTNSVHPDIVA
RAVVDTTIAIIPASAFRRLTRLYPRATAHIIQVILTRLQRVTFATAHSYLGLTTDVLSIE
KKMNKFTSFDLPNDLRGAPLDRLKQKFQRAVQRLGPEEGSKGIALHNPGVSNRRRSSSSL
RKDASLRAKASAANGQATSPPTPPITDKEAAGVSPGDLLSTIQLSRFGPRHGIDRRLASR
SILLDSTSTSGIKTPMHTSPDASSPANSIFNSPSTVHVNEDSLFRESILDCMVKALGLTA
TTREALPLPKGFGSADGSPHLVSYDSRKQKAVFNNAFGYIDPYEAFGDGDSESQMSISVT
SAGGTPPVANLKAELSNEIEIVYFPKGSVLVEQGERNPGLYYVIDGFLDVGIPVNDKGED
LIGPSKSNIHSEPLLPLRRPSNVNAQNQRKKTSRRSLYMVKPGDLEGYIGSITSYRSFTD
VTAKTDVYVGFLPRICLERIADRYPLVLLSMAKRLTNVLPRLLLHIDFALEWVQVNAGQV
IYHQGDESDSIYIVLNGRLRSVLESGDNKVSVVGEHGQGESVGELEVMTETTRPATLHAI
RDTELAKFPRSLFNSLAQEHPGITIQVSKLVAQRMKHLINTKLLEAGGEKAHDEASSLTS
TLNLRTVAILPVTSGIPVVEFASRLLSAFNQIGVPDGVASLHQADIFNHLGRHAFNRMGK
LKLSQYLADLEERYGMLIYVADTSVNAPWTQTCISQADCILLVGVAGASPSIGEYERFLL
GMKTTARKELVLLHAERYSPPGLTRQWLKNRMWINGGHHHIQMTYRATPEPALPQIKKFG
TVLKQRVQVIQAEIQKYTSRRIRQEPLYSATTPFKGDFHRLARRLCGKSVGLVLGGGGAR
GIAHIGVITALEEAGIPIDIVGGTSIGAFIGALYARDADVVPMYGRAKKFAAKMGSIWRF
ALDLTYPSVSYTTGHEFNRGLFKAFTDSQIEDSWLEFYCNTTNISQSRSDYHSSGYVWRY
VRASMSLAGLLPPLCDEGSLLLDGGYVDNLTVSRMKSLGADVIFAVDVGAIDDNTPQVYG
DSLSGFWTVLNRWNPFTSVPNPPTLSEIQARLAYVSSVDALERAKNTPGCLYMRPPIDCY
GTLEFGKFDEIYQVGYQYGKGFLEKLRKEGSLPMPEETEEKKNMRRTMAPRRASI
NT seq 4488 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgcggtgtcgccccgccagctcgagctcgagcaactctcctcctcctcctcc
tcctcctcctcctcctcctcatgtaccccctcttgcccacaatatcccgcgcactcgcag
tatacaatggccgatttcgccggtaccatcttcctcttcttcgtccaggtcctccccggg
ctgctctactcggtcattacctttaccaccattaccgtcccaacagccctgttcaccctc
ttctcgatgagcttaaccttcacaatgaatttcacgacattactattaataaccctcttc
ctcgtctcaacaatcagctggttcgtccgctatcggttcttgaatatgtacgctcacctc
cctccggaaccgcagcggcaggaaccacagatagaccttttcccagacacccaggaggga
gactcaaagccgggactagccaactatctagatgaatttttgagtgctataaaggtcttc
ggttacttggaacggccggtctttcacgaattaacccggacgatgcagacccgaaaactt
attgcgggcgagacacttttgttagaggaagaaaaagggttctgtcttgtggttgatggc
cttgtacagatatttgtcaagtcggcgagggagcgtggtaaggatggagaaagttccgtg
gaagactcaatggaagaggaagaagaacagcaccaccgtcatcaccaggggtaccagtta
ctcacagaagtgaagaacggtgcatccatgtcctctctcttctccatactatctctgttc
agtgaagatgtgaagctccgctatcaggaaggggaagagcctgcttcacccagccctgta
agcccttcaccgttcgccagcagcccgcggtcttccttccaagaccgccaccatcatcac
cgcgacatatccctcccatccaacggcggacgccttcctacagtaccgcccatgacatta
gacgataccaactccgccgctcatttctctacagctcacaccccaccaacttcttctgct
cagaatcgacgtaccccaaagcgtccgagaacaaattccgttcatccagatatagttgct
cgcgctgtggtggatacgaccattgccataattcctgccagtgcatttcgtcgtcttact
cgactatacccccgtgcgacagcccatattatacaagtcattttgactaggctgcaacgt
gtgacttttgccacagcccattcatatcttggcctcactacagatgtcttgagtatagaa
aagaagatgaacaagtttacttcctttgatttacccaatgatctccgcggggcgccactg
gatagactcaaacagaaatttcagagagccgtacaacgtcttgggccggaagaaggctca
aagggaattgctctacacaaccctggtgtcagtaataggcggagatcgagcagttctctg
cggaaagatgcttcattaagggccaaggcgtctgccgcaaacgggcaggctacatcacca
ccaaccccgcctatcactgataaagaggcagcaggtgtaagtcccggagatttgctttcc
accattcagctatctagatttggcccacggcatggtatcgatcgacgactcgcttcacgg
agtattctcctcgactcgacttcaacttctgggattaaaactccgatgcatacttccccc
gatgccagttcacctgcaaattccatttttaattcgccctctactgtccatgtaaacgaa
gatagcctcttccgcgaatcgatactcgattgtatggtgaaggcattgggtctaacagca
actacgcgggaagctctcccacttcccaaaggttttgggtccgctgatggctctccacat
ctggtctcttacgactcgcggaaacaaaaagcggtgtttaacaacgcgtttggctacata
gatccatatgaggcgtttggggatggtgactccgaatctcagatgagcatttctgttaca
agcgcaggcggtacgccgccagtagccaatctgaaagccgagttgagcaatgagatcgaa
attgtctactttcccaaaggttcagttttggtggaacagggagagcgtaacccgggatta
tattacgttatcgacggctttttagatgttggtatcccggtgaatgataaaggagaagac
ctgatcggtccatcgaagagtaacattcactccgaaccgctgcttccccttagaagacca
tcaaacgtcaatgcacaaaatcagcggaagaagacctcccgtcgatccctatatatggtc
aagcctggggatttagagggttacattggttccataacttcatatcgatctttcacagac
gtcacggcgaagacggacgtgtatgtcggtttcttaccgcgaatatgccttgaaagaatt
gccgatcggtacccgcttgtgcttctctctatggcgaaacgactaaccaatgtccttcct
cgtctcctgctacatatcgatttcgccctggaatgggtacaggtcaatgccggccaagtc
atctatcatcaaggagatgagagtgactctatctacatagtgctaaatggacgtttacga
tcagttcttgaatctggtgataacaaagtaagcgtggttggtgagcatggacaaggcgag
agtgtgggtgagcttgaagtcatgaccgaaacaactcgtcctgccactttacatgcaata
cgagatacagaactagccaaatttccccgttcgctattcaacagccttgcacaggagcat
cctggaataacaatacaggtgtctaaactggttgctcagcgcatgaaacatctgatcaac
actaaactacttgaagccggtggtgaaaaggctcatgatgaagcaagcagccttacttca
acgctgaatctgcggacagtcgcaatccttcctgtgacatccgggataccagttgtagag
ttcgcaagtcgtctcctcagcgcattcaaccagataggggttccagatggggttgcctcg
ttacaccaggcggatatatttaatcatctggggcgccacgctttcaaccgtatgggaaag
ctaaagctttcacaatatcttgctgaccttgaagaacggtatggaatgcttatatatgtc
gctgatactagtgtcaatgccccttggacgcaaacctgtatcagccaggccgactgcatt
ctcctagtaggtgttgctggagcctcacccagtattggcgaatacgagcgtttcctctta
ggaatgaagacgacagctagaaaagaactagtcctgttgcacgcagaacgatactctcca
cctggtcttacaaggcagtggcttaaaaaccgcatgtggattaacggtgggcatcatcac
attcaaatgacatatcgtgctacccctgaacctgcactaccacaaatcaaaaaattcggt
actgtcctcaagcaacgcgtgcaagttatccaggctgaaatacaaaagtatacctcacga
cggatccgccaggagcctctatattctgcaacaactccgttcaagggggattttcaccga
ctagcacgtagattgtgcggcaagtccgttggcttagtgcttggaggaggtggagctcga
ggtattgctcacataggagttatcacagcactggaggaagccggtattccaattgatatt
gtaggcggcacatctatcggtgcattcatcggtgcactctacgctcgtgatgcagatgtg
gtgcctatgtatggccgagcaaagaaatttgcagccaagatgggcagtatctggcgattt
gcattggatctcacatacccttctgtctcctacacaacgggccacgagttcaaccgtggg
cttttcaaagcattcaccgacagccagatcgaagattcctggcttgagttctattgcaac
accacgaatatcagtcagtctagatcggactaccattcttcgggctacgtatggcgctac
gtacgtgcatcaatgtcactagctggcctccttccgccgctctgtgacgaaggtagcttg
cttctggacggcggatacgtggataatttgactgtttcacgcatgaaatctctcggtgca
gacgtcatattcgccgtggacgtgggtgccatcgacgacaacactccacaggtatatggt
gactcactatctggattctggacagttctcaatagatggaatccatttactagcgtccct
aatccgcccactctctccgagatccaagcccgtcttgcctatgtctcatccgtggacgca
cttgagcgggcaaaaaacaccccaggatgtctttatatgcgtccaccaattgactgctac
gggactctggaatttggcaagtttgatgaaatataccaagtaggctatcagtatggaaag
ggattcctagagaagctcaggaaggaaggctctctgccaatgccagaagagaccgaagag
aagaagaacatgcggaggactatggcgccaagacgagcgagtatttaa

DBGET integrated database retrieval system