KEGG   Arthroderma benhamiae: ARB_05993Help
Entry
ARB_05993         CDS       T01611                                 

Definition
(RefSeq) hypothetical protein
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
abe  Arthroderma benhamiae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ARB_05993
   01230 Biosynthesis of amino acids
    ARB_05993
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ARB_05993
   00030 Pentose phosphate pathway
    ARB_05993
   00051 Fructose and mannose metabolism
    ARB_05993
   00052 Galactose metabolism
    ARB_05993
  Energy metabolism
   00680 Methane metabolism
    ARB_05993
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    ARB_05993
Enzymes [BR:abe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ARB_05993
Protein phosphatases and associated proteins [BR:abe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ARB_05993
Messenger RNA biogenesis [BR:abe03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     ARB_05993
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 778 aa AA seqDB search
MAAPTPVAAPAKQRRIAVLTSGGDAPGMNGAVRAVIRMSIHCGCEAYAVHEGYDGLVQGG
DYFRQMFWEDVRGWLSRGGTLIGSARCKAFREREGRLKAAKNMVIRGIDALIVCGGDGSL
TGADIFRSEWPGLLEELVKNGELSSKQIEPFKSLNIVGLVGSIDNDMSLTDATIGCYSSL
HRICEAVDEVFDTASSHQRGFVIEVMGRHCGWLALMSAISTGADWLFIPEMPPRDGWEDD
MCDIITQNRRRGKRRTIVIIAEGAQDSHLEKITSNKVKDILSDRLQLDTRVTVLGHTQRG
GAACAYDRWLATLQGIEAVKAVLEAKPGSPSPIITIRENKIERTSLVEAVRVTKSVSEAI
AKKDFATAMALRDSEFMALHRAYINTTTPHHPKLLLPEAKRMRIAIIHVGAPAGGMNPAT
RGAVAYCLARGHTPIGIYNGFPGLCRHHDDKPLGSVREVKWLESDSWVNEGGSEIGTNRG
LPSEDMETTAKCFELYKFDALFVIGGFEAFTAVSQLRKARKDYDAFKIPMIQLPATISNN
VPGTEYSLGSDTCLNTLVNFCDVIRQSASSSRRRVFVIETQGGRSGYIATIAGLSVGAYA
VYIPEEGISIKMLANDIENLRKSFATDRGANHAGKIILRNERASATYTTQVIADMIKEEA
KGRFESRSAVPGHFQQGGKPSPMDRIRALRMSLKCIQHFEEYADKSPDEIAADDMSTVVI
GIRGSEVVFSPLGGKDGLEATDTDWEHRRPKNEFWLKFREMVDTLSGRPDGNYKTDDA
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atggctgcccctacgccagtggcagctccggctaagcagcgccgcatcgccgttctaact
agtgggggggatgcgcctggaatgaacggggccgtgagagccgttatccgcatgtcgatt
cactgtggttgcgaggcctacgctgttcacgaagggtacgatggtctggtgcagggaggg
gactactttaggcaaatgttctgggaggatgtccggggatggctgtctcgtggaggaaca
ttgatcgggtctgcaaggtgcaaggccttcagagagcgtgaggggaggctaaaagccgct
aagaatatggttattcgtgggattgatgcccttattgtgtgtggcggtgatggctcgctg
actggagctgatatctttcgctccgagtggcccggtctactggaagagctggtgaagaat
ggagagctcagctcaaaacagattgagcccttcaagtcgttgaatattgttggactggtg
ggctctattgacaatgacatgtccttaacagatgctaccattggctgttactcgtccctg
caccggatctgtgaggctgtggacgaggtctttgataccgcttcttcccaccagcggggt
tttgttatagaggtcatgggtaggcattgtggatggttggcattgatgtctgccatcagt
accggagcggactggctgtttattcctgagatgcctccccgagacggctgggaggatgac
atgtgtgatatcatcactcagaaccgacgaagaggtaaacgacgaactattgttatcatt
gctgagggagcccaggacagtcatcttgaaaagatcacgtccaataaggtcaaagatatt
ctcagtgatcggctgcagctcgacacccgagtcactgtcctagggcatacacaacgaggt
ggcgcagcctgtgcctatgaccgatggctagctacactccagggcattgaagctgtcaag
gctgtcctagaagccaagccgggctccccttcgccaatcatcactatccgagagaacaag
atcgaaaggacctccttagtcgaggctgtaagggttacgaaaagtgtctctgaggccata
gcgaagaaggactttgctactgccatggcactgcgtgactccgaattcatggctctccac
agagcatatatcaacactaccacaccacaccatccaaaactgctacttccagaagcgaag
agaatgcgtattgctattattcatgtcggagctccagctggtggaatgaaccccgctacc
cgaggtgcagtagcatactgtctggctcgcggccacactcccattggaatctacaatggc
ttcccaggtctctgtaggcatcatgacgataaacccctgggctctgtcagagaggtcaaa
tggctcgagtcggactcgtgggtcaacgagggtggctcagaaattggtactaaccgtggc
ctcccatcagaggacatggagaccactgccaaatgctttgagctctataaatttgatgcc
ttatttgtcatcggaggctttgaagcattcactgctgtaagccaattgcgaaaagcaaga
aaggactatgatgccttcaagatcccgatgatccagctacctgctactatctccaacaac
gtccccggaacagaatactccctgggaagtgatacttgtctcaacaccctggttaacttt
tgcgatgtcattagacagtcagcttcctcctctcgacgtcgagtgtttgttattgagacg
caaggaggacgatctggttacattgcaaccatcgctgggttgtccgtcggcgcatacgca
gtgtatatccccgaagagggtatcagtatcaagatgcttgccaacgacatcgagaatcta
cgaaaaagctttgctaccgaccgcggtgccaaccacgctggcaagattatcctacgcaac
gagcgtgcctccgccacatacaccacccaagtgatagccgacatgatcaaggaagaggct
aagggacgattcgaatcccgctctgctgtcccaggtcacttccagcagggcggcaagccc
tctcccatggatcgtatccgcgcccttcgcatgtctctcaaatgcattcaacattttgaa
gagtatgctgacaagagcccggacgagatcgcggcagacgacatgtctaccgtcgtcatc
ggcattcgaggtagcgaggtggtcttcagcccccttggtggtaaggatgggctggaagcg
actgacaccgactgggagcaccgacggcccaagaacgagttctggctcaaattccgagag
atggtcgatactttaagcggccgacccgacggcaactataagacggacgatgcgtga

DBGET integrated database retrieval system