KEGG   Arthroderma benhamiae: ARB_06127Help
Entry
ARB_06127         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
abe  Arthroderma benhamiae
Pathway
mRNA surveillance pathway
Meiosis - yeast
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:abe03015]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:abe04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 349 aa AA seqDB search
MADQNEIDLDSIIDRLLEVRGSRPGKQVQLLESEIRHLCTKAREIFISQPILLELEAPIK
RKRRKKKKTNSRKICGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLL
LAYKIKYPENFFVLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDE
KIFTMHGGLSPDLNSMEQIRRVMRPTDLDYLLLFFMHGIPDCGLLCDLLWSDPDKDITGW
SENDRGVSFTFGPDVVSRFLQKHDMDLICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEF
DNAGAMMSVDESLLCSFQILKPAEKKQKYVYGGMAPNRPITPPRKQKKK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggcggaccagaacgagatcgatttggattcgatcattgatagactgttggaggtgagg
ggcagtcgtcccggaaagcaggtccagctgctcgagtccgagatccgccatctttgcacc
aaggctagagagatcttcatttcgcagcctatacttttggagttggaggccccgataaag
agaaagaggagaaagaaaaaaaaaactaactcgcgcaagatatgcggtgatattcatggc
cagtactacgatctcttgcgcctgttcgagtacggaggtttcccgccggaagccaactac
ctcttcctaggcgactacgtagaccgaggcaagcagtctctcgagaccatctgtctactc
ctcgcatacaagatcaaatatccagagaacttcttcgtgctccgcggcaaccacgagtgc
gcttccatcaaccgtatctacggcttctacgacgagtgcaagcgaagatacaacatcaag
ctctggaagacctttaccgactgcttcaactgcctcccaattgccgccatcatcgacgag
aagatcttcaccatgcacggtggtctcagtcccgatctcaactccatggaacagattcgc
cgtgtcatgcgtccaacagatcttgattatttattactcttttttatgcatggcattcct
gactgcggtctcctctgcgatctcctctggtctgatcctgacaaggacatcaccggctgg
agcgaaaacgatcgaggtgtctccttcacattcggccccgacgtcgtctcgcggttcttg
cagaagcatgacatggacctcatctgtcgagcacatcaggtagtcgaggatggctacgag
ttcttctccaagcggcagctggtcacgctcttcagcgcaccaaactactgcggagaattc
gacaatgccggagctatgatgagtgtagacgagagccttctctgttcattccagatcctg
aaaccagccgaaaagaaacaaaagtacgtctacggaggcatggcacctaacagacccatc
actcctccaaggaagcagaagaaaaagtaa

DBGET integrated database retrieval system