KEGG   Arthroderma benhamiae: ARB_06238Help
Entry
ARB_06238         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
abe  Arthroderma benhamiae
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:abe00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    ARB_06238
Messenger RNA biogenesis [BR:abe03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     ARB_06238
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     ARB_06238
Translation factors [BR:abe03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    ARB_06238
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 240 aa AA seqDB search
MAAENGTKPEQAVNNENSTPDGTEPQNKDEQITVFHDPINFNVKHPLMNEWTLWFTKPPS
GKGDNWNDLLKEVVTFNSVEEFWGIYNNIAPTSQLSFKSDYHLFKKGVRPEWEDQQNKHG
GKWSYSFKFTKDRNQVPIDELWLHAQLTVIGDTLENDGDNEVMGVVVNVRKSFYRIGLWT
RTIGRASNERSQDQAQKILLAIGRRFKEVLKLKDNELLEFSGHTESANAGSTRAKAKFTV
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggaaaacggaaccaagcccgaacaggccgtgaacaacgagaactccactcca
gacggcactgagcctcagaacaaggatgaacagatcacggtcttccatgatcccatcaac
ttcaacgtcaagcaccctctcatgaacgaatggactctgtggttcacaaaacctccaagt
ggcaagggcgacaactggaacgatctgctcaaggaagtcgtcacttttaactccgttgaa
gaattctggggaatatataataatatcgcgcctacctctcagctcagcttcaagtcagac
taccatctattcaagaagggagtcagaccagaatgggaagaccaacaaaacaaacatggc
ggcaagtggtcgtactcttttaaattcaccaaggaccggaaccaggttcccatcgacgaa
ctctggctacatgcccaacttacggtgattggagatactctcgaaaatgacggtgacaac
gaagtcatgggagttgtcgttaacgtgcgcaaatctttctaccgaattggtctatggacc
cgaacaattggacgtgctagcaatgagcgctcgcaagatcaagcacagaagattctcttg
gctattggcagacggttcaaggaagttctcaaactgaaggacaatgagctcctcgagttc
tccggccacactgagagtgccaatgcaggaagcacccgtgctaaagcgaagtttacagtc
tga

DBGET integrated database retrieval system