KEGG   Arthroderma benhamiae: ARB_06238Help
Entry
ARB_06238         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
abe  Arthroderma benhamiae
Pathway
RNA transport
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:abe03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 240 aa AA seqDB search
MAAENGTKPEQAVNNENSTPDGTEPQNKDEQITVFHDPINFNVKHPLMNEWTLWFTKPPS
GKGDNWNDLLKEVVTFNSVEEFWGIYNNIAPTSQLSFKSDYHLFKKGVRPEWEDQQNKHG
GKWSYSFKFTKDRNQVPIDELWLHAQLTVIGDTLENDGDNEVMGVVVNVRKSFYRIGLWT
RTIGRASNERSQDQAQKILLAIGRRFKEVLKLKDNELLEFSGHTESANAGSTRAKAKFTV
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggaaaacggaaccaagcccgaacaggccgtgaacaacgagaactccactcca
gacggcactgagcctcagaacaaggatgaacagatcacggtcttccatgatcccatcaac
ttcaacgtcaagcaccctctcatgaacgaatggactctgtggttcacaaaacctccaagt
ggcaagggcgacaactggaacgatctgctcaaggaagtcgtcacttttaactccgttgaa
gaattctggggaatatataataatatcgcgcctacctctcagctcagcttcaagtcagac
taccatctattcaagaagggagtcagaccagaatgggaagaccaacaaaacaaacatggc
ggcaagtggtcgtactcttttaaattcaccaaggaccggaaccaggttcccatcgacgaa
ctctggctacatgcccaacttacggtgattggagatactctcgaaaatgacggtgacaac
gaagtcatgggagttgtcgttaacgtgcgcaaatctttctaccgaattggtctatggacc
cgaacaattggacgtgctagcaatgagcgctcgcaagatcaagcacagaagattctcttg
gctattggcagacggttcaaggaagttctcaaactgaaggacaatgagctcctcgagttc
tccggccacactgagagtgccaatgcaggaagcacccgtgctaaagcgaagtttacagtc
tga

DBGET integrated database retrieval system