KEGG   Arthroderma benhamiae: ARB_06318Help
Entry
ARB_06318         CDS       T01611                                 

Definition
NADPH-cytochrome P450 reductase (CprA), putative
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
abe  Arthroderma benhamiae
Brite
Enzymes [BR:abe01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     ARB_06318
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 694 aa AA seqDB search
MAQVDTLDMLVLAVILVGTIAYFTKGKYWAVVKDPYASSYAATNSAKQGQTRNIVEKLEE
TGKNCVIFYGSQTGTAEDYASRLAKEGSQRFGLKTMVADLEDYDYACLDKFPEDKVAFFV
LATYGEGEPTDNAVEFFQFITGDDASFEDGGSPEDQPLSKMRYVAFGLGNNTYEHYNAMV
RIVDKALTKCGAKRIGDAGEGDDGAGTMEEDYLAWKEPMWKALAEEMGLEEREAIYEPTF
SVIEEADLNTESENVYLGEPNASHLKSRGQGPYNAHNPFLSPIVESRELFSVKDRNCLHM
EFDIKGSQLNYQTGDHIAIWPTNAGQEVDRFLKVFGLEEKRHTVIRVKPIDVTAKVPFPQ
PTTYDSVVRYYIETCGPVSRQFISQLAAFAPDEETKKKMIRIGEDKDVFSDKVSAFYFNI
AQALQSFTDKPFTAVPFSLLIEGIPKIQPRYYSISSSSIVQKEKISITAVVESLRVPGAG
HVVKGVTTNYLLALKQKQHGEPNPDPFGLTYAISGPRNKYDGFHVPVHVRHSNFKLPSDP
SKPIIMVGPGTGVAPFRGFIQERVHQAEKGETVGPTILFYGCRKSTEDFLYKEEFEEVSK
KLGDSFKLITAFSRETSQKVYVQHRLKEHAELVSDLLSKKANFYVCGDAANMAREVNVVL
GQILAEQRGLKPEKGEELVKHMRNTGSYQEDVWS
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggttgatactctggacatgcttgtcctggcggtcatactcgtcgggacgata
gcatacttcacgaagggcaaatactgggccgtcgtaaaggacccctatgcctcctcctac
gccgcaacaaacagcgcaaagcaaggtcagacccggaatatcgtcgagaagctcgaggaa
accggcaagaactgtgtcatcttctatggctcgcagaccggtactgccgaagactatgcc
tccaggctggcgaaggagggatcccagcgattcggcctcaagaccatggttgccgatctg
gaagactatgactatgcctgcctcgataaattccccgaagacaaggttgccttcttcgtc
ctggctacctacggtgagggtgaaccgacagataacgcggttgagttcttccagttcatc
accggtgacgatgccagctttgaagatggcgggtcgccggaagaccagccgctctccaag
atgcgatatgttgcgtttggcctcgggaacaacacctacgaacactacaacgccatggtt
agaattgtggataaggctctgaccaagtgtggtgctaagagaatcggtgatgctggagaa
ggtgatgacggtgctggaaccatggaagaggactatctcgcctggaaggaacccatgtgg
aaggctctggctgaagagatgggccttgaagagagagaggctatctacgaacctaccttc
agcgtcattgaagaagcggacttgaacaccgaatcggagaatgtctatctcggcgagcca
aacgcttctcacctcaagagtcgaggccagggaccttacaacgctcataacccattcctc
tcacccattgtcgagtctcgcgaactgttctccgtcaaagaccgtaactgcctgcacatg
gaattcgacatcaagggaagccagctcaattaccagaccggtgaccacatcgctatctgg
cccaccaatgccggccaggaagtcgaccgtttcctcaaggtgtttggtctggaagaaaag
cgccatactgtcatccgtgttaagcctattgatgtcactgccaaagtcccgttcccccag
ccaaccacctatgactccgtggtcagatactacattgaaacctgcggccccgtatcgcga
cagttcatctcccagctcgctgcattcgctccggatgaagagaccaagaagaagatgatt
cgcattggcgaagataaagacgttttctcagacaaggtgtctgccttctacttcaacatt
gcccaggctctgcaatccttcaccgataagccctttaccgccgttccgttctccctgctt
atcgaaggcatccccaagatccagccaagatactactccatttcttcatcgtctatagtc
cagaaggaaaagatcagcatcactgctgttgtcgaatcattacgtgtccccggtgccggc
catgttgtcaagggtgtaacaaccaactatcttcttgctttgaaacagaaacagcatggc
gagcccaacccagatccattcggcctgacctatgccatttctgggccacgcaacaaatac
gatggcttccatgtccctgtccatgtgcgtcactccaacttcaagcttccgtctgatcct
tcgaagccaatcatcatggttggtcctggtaccggtgtcgctccattccgtggtttcatc
caggaacgagtccaccaggctgaaaagggcgagaccgtcggtcctactatccttttctac
ggctgccgtaagagcacagaggatttcctttacaaggaagagttcgaggaggtgtccaag
aaactcggtgattccttcaagcttatcactgctttctctcgtgagacttctcagaaagta
tatgtccaacaccgtcttaaggaacacgccgagctagtcagcgaccttctctccaagaag
gcaaacttctatgtctgcggagatgcagccaacatggctcgagaagtcaacgttgtccta
ggtcagatactcgctgagcaacgaggcctgaaacccgagaagggtgaggaactcgtcaag
catatgcgaaacaccggctcgtaccaggaggatgtctggtcgtga

DBGET integrated database retrieval system