KEGG   Trichophyton benhamiae: ARB_06322Help
Entry
ARB_06322         CDS       T01611                                 

Definition
(RefSeq) possible replication factor-a protein
  KO
K10739  
replication factor A2
Organism
abe  Trichophyton benhamiae
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:abe00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ARB_06322
   03420 Nucleotide excision repair
    ARB_06322
   03430 Mismatch repair
    ARB_06322
   03440 Homologous recombination
    ARB_06322
DNA replication proteins [BR:abe03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    ARB_06322
DNA repair and recombination proteins [BR:abe03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     ARB_06322
   MMR (mismatch exicision repair)
     ARB_06322
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     ARB_06322
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 274 aa AA seqDB search
MENLQWNCLRLTYSGESRSVRPVTIKQLNDATQAFPEAPFKIDNADINQVSFVGQVRNVN
KLATHITYKLDDGTGETDVKYFIPPEEKEAFDELEAMDVMAMDGGGSNAGPAAVTNKSGR
PRAHQITTNGYAKVFANVKTFNDRRQVNAVLIRPITNINEYHVHFLEATAVHLYFTKGPP
PKAGGASGVGAGTGGGAMDMGGSNLSLPRMSPMARKLYDALSNSKQTNEGMHVNVLAPIM
QVNVNEVYKAAEELLGLSVIYHTVDEDTWKILDC
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggagaacctgcagtggaattgtctccgccttacatactccggtgaatctagatcagtt
cggccagtgaccatcaaacaattaaacgatgccacccaggcattccccgaagcccccttc
aaaatagataacgccgatatcaatcaagtatcctttgtgggacaagttcggaatgtcaat
aaactagccacacacatcacgtacaagctagacgacggcactggagagacagatgtgaaa
tatttcatccctcctgaagaaaaagaagcgttcgatgagcttgaagccatggatgtcatg
gctatggatggtgggggtagcaatgctggtccagctgctgtgacaaacaagtctggacga
ccgagagcccaccagataacaacaaacggatacgcaaaggtgtttgccaatgttaaaaca
tttaatgaccggcggcaggttaacgcggtgttaatcaggcccataacgaatattaacgag
taccatgttcatttccttgaggccacagcagtacatctctattttaccaagggcccgcca
ccgaaggcaggtggtgcttctggagtgggagccggaaccgggggtggtgcgatggatatg
ggtggcagcaatctctccctaccgcgaatgtcaccgatggcacgaaaactatacgatgct
ctcagcaacagcaagcagaccaatgagggcatgcatgtgaatgtcctggcgccgataatg
caggtgaacgtaaatgaagtctataaagctgccgaggagctcctgggactcagtgtgata
taccacacggtagatgaggacacctggaagattcttgactgttga

DBGET integrated database retrieval system