KEGG   Arthroderma benhamiae: ARB_06322Help
Entry
ARB_06322         CDS       T01611                                 

Definition
possible replication factor-a protein
Orthology
K10739  
replication factor A2
Organism
abe  Arthroderma benhamiae
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:abe00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ARB_06322
   03420 Nucleotide excision repair
    ARB_06322
   03430 Mismatch repair
    ARB_06322
   03440 Homologous recombination
    ARB_06322
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 274 aa AA seqDB search
MENLQWNCLRLTYSGESRSVRPVTIKQLNDATQAFPEAPFKIDNADINQVSFVGQVRNVN
KLATHITYKLDDGTGETDVKYFIPPEEKEAFDELEAMDVMAMDGGGSNAGPAAVTNKSGR
PRAHQITTNGYAKVFANVKTFNDRRQVNAVLIRPITNINEYHVHFLEATAVHLYFTKGPP
PKAGGASGVGAGTGGGAMDMGGSNLSLPRMSPMARKLYDALSNSKQTNEGMHVNVLAPIM
QVNVNEVYKAAEELLGLSVIYHTVDEDTWKILDC
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggagaacctgcagtggaattgtctccgccttacatactccggtgaatctagatcagtt
cggccagtgaccatcaaacaattaaacgatgccacccaggcattccccgaagcccccttc
aaaatagataacgccgatatcaatcaagtatcctttgtgggacaagttcggaatgtcaat
aaactagccacacacatcacgtacaagctagacgacggcactggagagacagatgtgaaa
tatttcatccctcctgaagaaaaagaagcgttcgatgagcttgaagccatggatgtcatg
gctatggatggtgggggtagcaatgctggtccagctgctgtgacaaacaagtctggacga
ccgagagcccaccagataacaacaaacggatacgcaaaggtgtttgccaatgttaaaaca
tttaatgaccggcggcaggttaacgcggtgttaatcaggcccataacgaatattaacgag
taccatgttcatttccttgaggccacagcagtacatctctattttaccaagggcccgcca
ccgaaggcaggtggtgcttctggagtgggagccggaaccgggggtggtgcgatggatatg
ggtggcagcaatctctccctaccgcgaatgtcaccgatggcacgaaaactatacgatgct
ctcagcaacagcaagcagaccaatgagggcatgcatgtgaatgtcctggcgccgataatg
caggtgaacgtaaatgaagtctataaagctgccgaggagctcctgggactcagtgtgata
taccacacggtagatgaggacacctggaagattcttgactgttga

DBGET integrated database retrieval system