KEGG   Arthroderma benhamiae: ARB_06487Help
Entry
ARB_06487         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
abe  Arthroderma benhamiae
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:abe00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 775 aa AA seqDB search
MASPSSSVRHRGGKKNGESPTPSPAAASGLKSAENKPAVKKGKGQTESSSEWDYRLALVI
VTIGAFATRFWKISYPDQVVFDEVHFGKFASLYIQGTYFFDVHPPFAKLLFALVGWLVGF
DGKFLFENIGDSYTDNKVPYVALRALPAMLGSLTVPVVFLIMWESGYSLPACVLSAGLLL
FDNAHIGEDRLILLDATLVISMALSVLCYIKFHKNRHQPFSRKWWKWMLMTGIALSCVIS
TKYVGVFTFVTIGSAVLIDLWGLLDVNRRRGKLSLFEFGTHFAARAFGLIIVPFFIYLLW
FQVHFAILTKSGPGDDFMSPEFQASLSDNPMFAQSKGVEYYDVLTFRHKDTKVYLHSHPD
RYPLRYDDGRVSSQGQQVTGYPHNDTNNHWEILPQVPFASDNRTGHKVRNGHIVQLRHVA
TNTFLLSHDVASPSYPTNQEFTTTSPEEAAGNRHNDTLFEIQVPKGKADEEFRTRSSLFN
LIHFPSKVAMWTHTNPLPDWGYKQAEINGNKNSKDPSNLWYAEDIPSLAPDSPRSHQEPR
KVQPMRFLKKYLELQAAMFHHNNALTSSHPYASEPFQWPFLLRGVSFWTKNDTREQIYFL
GNPVGWWLCSSLLAVFVGILGADQLALRRGIDALEEIWGPGTRHRLYNSTGFFFLCWAAH
YFPFYLMGRQRFLHHYLPSHIASVLVTGALVEFIFNIDPAGLSEDFVASKPGHGPLKIKH
TRQSLLAIWAATIAILGATIWGFGFFAPLTYGTPGLDVAGINARKWLSYDLHFAK
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccccgtcctccagcgttcgacaccggggcggcaagaagaacggcgagagccct
accccctctccagcagctgcgtcgggcttgaagagcgctgagaataagccagctgtaaag
aagggaaagggacagaccgagtcctcgtcagaatgggattacagacttgccctggtcatt
gttaccattggcgcgtttgctacgaggttctggaagatcagctatcctgaccaggtggtg
tttgatgaagtacacttcggaaagtttgcttcactttatatccaaggcacatacttcttc
gatgtccacccgccgtttgccaaactcctctttgcgctggtcggctggctggttggattc
gatggaaaattcctgtttgaaaacattggagactcgtacacggacaacaaggtgccttat
gttgcccttcgcgctctaccggccatgcttggctccctgaccgtccccgtcgtgtttctc
attatgtgggaatctggctactcgctccctgcctgtgttctttccgccggtcttctcctg
ttcgacaatgcccatatcggcgaggataggctgattctgctcgatgccactcttgtcatt
tcaatggcattgagtgtgctctgctatatcaaattccacaagaacagacaccaacctttt
agccgaaagtggtggaaatggatgcttatgaccggcattgctctcagctgtgtcatctcg
accaagtatgttggtgtcttcaccttcgtgaccatcggatctgctgtcttgatcgatcta
tgggggttgcttgatgtgaaccgccgccggggcaagcttagtctcttcgagtttggtacc
catttcgctgctcgtgcgttcggcttgatcatcgtcccctttttcatctacctcctctgg
ttccaggtccattttgctattctcaccaagtctggccccggtgatgacttcatgagccca
gagttccaggcctcgctcagtgataaccccatgtttgctcagtccaagggagtcgaatac
tatgatgtacttactttccgacacaaggacaccaaggtctacctacacagtcaccctgac
cgctatcctcttcgatatgatgacggccgtgtctccagtcagggccagcaggtcaccgga
taccctcacaacgacaccaacaaccactgggaaatcctgcctcaggtcccctttgcttct
gataaccgtaccggacacaaagttcgcaatggacatatcgtgcagctccgccatgtcgct
accaacaccttccttctctcacacgatgttgcgtctcccagctacccaaccaaccaggag
tttaccactacctcccctgaagaagcggctggcaaccgacataacgacaccttgttcgag
atccaggtccccaagggcaaggctgatgaggaattccgaacccgctccagcctgttcaac
ctgatccatttcccttcaaaggttgctatgtggactcataccaaccctctgccagactgg
ggatacaagcaggctgaaattaacggaaacaagaactccaaggacccaagcaacctctgg
tatgcggaagatatcccatctttggcgccggacagccctcgaagtcaccaggaacctcgc
aaggtccagccaatgcgtttcctgaagaagtacctcgaactccaggctgccatgttccac
cataacaacgccttgacgagcagccatccgtatgccagtgaaccgttccagtggcccttc
ttgcttcgtggtgtcagcttctggacaaagaacgacacccgagaacaaatctacttcctt
ggaaaccccgtcggatggtggctttgcagcagccttctcgcggtttttgtcggtattctc
ggagccgaccagcttgctctccgtcgtggaatcgacgccctggaagaaatctggggccca
ggaacccgtcaccgcctgtacaacagcaccggtttcttcttcctctgctgggcagctcac
tacttcccgttctatcttatgggcagacaacgcttcctgcaccactatctcccttctcac
atagcgtctgttctggtcactggcgccctggtcgagttcatcttcaacattgaccccgcc
ggtttgagcgaggacttcgtggcgagcaagcctggccatggcccgctaaagatcaagcac
acccggcagagcctcttggccatctgggccgctactatcgcgatcctgggagcaacaatc
tggggcttcggcttctttgctccactcacctacggaactccaggtttggacgttgctgga
atcaacgccagaaagtggctctcttacgacttgcactttgcaaagtaa

DBGET integrated database retrieval system