KEGG   Trichophyton benhamiae: ARB_06519Help
Entry
ARB_06519         CDS       T01611                                 

Definition
(RefSeq) enoyl-CoA hydratase/isomerase family protein
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
abe  Trichophyton benhamiae
Pathway
abe00062  Fatty acid elongation
abe00071  Fatty acid degradation
abe00280  Valine, leucine and isoleucine degradation
abe00310  Lysine degradation
abe00380  Tryptophan metabolism
abe00410  beta-Alanine metabolism
abe00640  Propanoate metabolism
abe00650  Butanoate metabolism
abe01100  Metabolic pathways
abe01110  Biosynthesis of secondary metabolites
abe01130  Biosynthesis of antibiotics
abe01200  Carbon metabolism
abe01212  Fatty acid metabolism
Module
abe_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ARB_06519
   00650 Butanoate metabolism
    ARB_06519
  Lipid metabolism
   00062 Fatty acid elongation
    ARB_06519
   00071 Fatty acid degradation
    ARB_06519
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ARB_06519
   00310 Lysine degradation
    ARB_06519
   00380 Tryptophan metabolism
    ARB_06519
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ARB_06519
Enzymes [BR:abe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ARB_06519
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 9521120
NCBI-ProteinID: XP_003015394
UniProt: D4AQL0
AA seq 311 aa AA seqDB search
MFARRCSRLVASQTARPLQSYISRFYSTGSPAYEYILTSTPKPGVGLITLNRPKALNALC
SPLFKELNEALTKYDEDKTIGAIIITGSEKAFAGTHYGWAMAYVGVSPSNLLLAGADIKE
MAPLTFAAAYNDNFIAPWSHLANTIRTPVIAAVSGYALGGGCELAMMCDMIYCTDKATFG
QPEIKLGTIPGAGGSQRLTKLVGKSKAMELILTGNTFSGKEAGQWGVAAKVVEGGKDELM
EATLETASKIASYSRVAVVAAKEVVNKSQELSLKEGVEFERRLFHGLFGSKDQKIGMTAF
AEKKKPEWSHE
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgtttgccagacgctgctcaagactcgtggcctcgcagactgcccggccattgcagtca
tacatctcccgcttctactcgactggatccccagcctacgagtacatcctcacatctact
cctaagcccggcgtcggattaatcactcttaaccggccaaaggctctcaatgccttgtgt
agccctctcttcaaggagctcaacgaggctctcaccaagtatgacgaagataagaccatt
ggcgctataatcatcaccggcagcgagaaggcatttgcaggtacgcattacggatgggca
atggcttacgtaggagtatctccttctaacttattactagctggtgccgatatcaaggaa
atggcccctctcaccttcgctgccgcctacaacgacaacttcattgctccttggtcgcat
cttgccaacacaatccgaactcccgtcattgctgcggtatccggatatgctctcggaggt
ggctgcgagctcgcaatgatgtgtgatatgatctactgcaccgacaaggccaccttcgga
cagccagagatcaagctcggcactatccccggagccggtggctctcagcgtctgaccaag
ctcgtcggtaagagcaaggccatggagcttatcctcactggaaataccttcagcggaaag
gaagctgggcagtggggagtagccgccaaggttgttgagggtggcaaggacgagcttatg
gaggctacccttgagactgctagcaaaatcgctagctacagccgtgttgctgttgttgct
gccaaggaggtcgttaacaagagccaggagctttcgctgaaggaaggtgtcgagttcgag
agaagactgttccacggtctctttggaagcaaggaccagaagattggtatgactgctttc
gctgagaagaagaagcctgagtggtctcatgagtga

DBGET integrated database retrieval system