KEGG   Trichophyton benhamiae: ARB_06692Help
Entry
ARB_06692         CDS       T01611                                 

Definition
(RefSeq) hypothetical protein
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
abe  Trichophyton benhamiae
Pathway
abe00562  Inositol phosphate metabolism
abe01100  Metabolic pathways
abe04070  Phosphatidylinositol signaling system
abe04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    ARB_06692
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    ARB_06692
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    ARB_06692
Enzymes [BR:abe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     ARB_06692
Membrane trafficking [BR:abe04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    ARB_06692
 Endocytosis
  Macropinocytosis
   Phospholipase C
    ARB_06692
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y C2 EF-hand_like EF-hand_8
Motif
Other DBs
NCBI-GeneID: 9520655
NCBI-ProteinID: XP_003014933
UniProt: D4ARF0
AA seq 1075 aa AA seqDB search
MNSPLSTSLDNPGPLDLPEGILSIPLHQSLTYPADAALVNAAPNTNNNTANNNNNNNNNS
IVSSNNNTNTTSNIKGPGLMRRISRGAANKLSRRRRSNSQDRRDKDSGPVTMLRRNNSKS
TTSASWDSALDSSYEEDESCDTLGTWCGPDSSKVKSDYQRSITSTASGVAPKVDPILQRG
CTLTKVNKLKKKPMTFYLDFDSGKMFWNLSNPTKRVYIDDIKEIRLRGDARMYREEHRIP
EEFENRWFTIIYNNSEGSKNRAVKTVHLIAPDEAMFELWTTTLENVARYRIGLMVGLTGS
VESEAILNAHWQREISRRASQDPRAMEEDSLDAEGIGNLCHSLHINCSKETIRILFARAD
TMGTGRVNFAQFREFFQLLKYRRDIKDLYNRLVTDDVQGMTLANFLDFVQYTQRENVQEN
RDYWVSIFEKFVRKARLRSQSQSDAPLPDDAPIRMSLDAFSAFLISSSNGIYPSHVPEPK
FDYPLNDYFISSSHNTYLLGRQVAGFSSTEAYVTALQKGCRCVEVDCWDGADGRPIVSHG
RTMTTSVLFADCISVINKYAFLSSDYPLIISLEVHCNPEQQLAMTNIIKDTFKEKLVLET
LGDDWPVLPSPEALKHRVLIKVKTSEEIIDTGPATTVPPGLVSAGRKRSSSSPFMPPTVL
EDPPHSLPPLSSPPTISSANEPVPPPLGRRAFTATSVCSTSEESDIGQSSAAIQKEKKRA
QKSRIVKDLADLGVYTRGYKFHSFNSAESKLFNHVYSFAERAFEGICRDSESKALLEAHN
RRFLTRVYPSGFRVRSSNFDPNIFWRRSVQMVALNWQTYDVGMQMNQAMFASGTDRTGYV
LKPESLRLPPPSWKGPGLKPKVDRKLVRFSIDVISAQQLPRPKQIGLDENINPYVEIEVF
SADDKTKGLAFGEGGMDTSDRNGLSGIGHPHRRRTGIEQGNAYNPIFNDQFKFSLETKYP
DLVFVRWVVWHSPDGRSVGNNSTQLATFTAKLSSLAQGFRYLPLYDGNGDQYLFSTLFCR
VTKSELAPVIPLFDTEETKNERRGILKQLGQSVLKRAISTERDSPKANITSNEQS
NT seq 3228 nt NT seq  +upstreamnt  +downstreamnt
atgaactcgcctttatctacctccctggataacccaggccctcttgacctccctgaagga
atactctctattccactccatcaaagcttgacgtatcccgctgatgctgcccttgtgaat
gccgcacccaataccaacaacaataccgccaacaacaacaacaacaacaacaacaatagc
attgtcagtagtaacaataatacaaataccaccagcaatatcaagggacccggcctgatg
agaagaatatcaaggggagccgccaacaagctttcccgacgacggcggtcgaactctcag
gatagacgcgacaaggactccggccctgtcaccatgctcaggcgcaacaatagcaagtca
acgacttcagcatcctgggatagcgctctagattcaagctacgaggaggatgagtcatgt
gataccctcgggacttggtgcggccctgacagcagcaaggtgaaaagcgactaccaacgg
tctattaccagtactgccagtggcgttgcccctaaggttgaccccatcctccagcgcggc
tgtaccctgaccaaggtaaacaagctgaagaagaaaccgatgactttttatcttgatttt
gactccgggaagatgttctggaacctgtcaaacccgaccaagcgggtatatattgatgat
attaaggagatacgactacgaggggatgctcggatgtacagagaggaacatcgtatcccc
gaggagttcgaaaaccggtggttcaccataatctacaataactccgagggttctaaaaac
cgagcggtcaagaccgtccatctaatcgcacccgatgaagctatgttcgagctctggacc
acgaccctggaaaatgttgcccgataccgcatcggcctcatggtaggcttgaccggttct
gtggagagcgaggccattctcaacgcccactggcaacgagagatatctagacgtgcttcc
caggaccctagggctatggaagaggacagtcttgatgcagaaggtatcggaaatttatgt
cacagtctgcacatcaactgctccaaggaaactatacgcatcctcttcgctcgggctgac
accatgggcactggaagagtcaactttgcgcaattcagggaattctttcaactgctcaaa
taccgccgagacattaaggatctgtacaatcgtctggttactgatgacgtacaaggtatg
accctggcaaactttctcgacttcgtccagtatacgcaacgcgaaaacgtccaggagaac
agggattactgggtttctatttttgaaaagttcgtccgcaaggctcgactgcgttcacag
agccagtcggatgcacctcttcctgatgatgcaccgatacgcatgagtctagatgccttc
tctgcgttcctgatatcgtcctccaacgggatctacccttcacatgttcctgagccaaaa
ttcgattacccactcaacgactacttcatttcaagttcacacaacacctatcttctggga
agacaagttgctggtttctctagcacagaagcgtatgtcactgcgcttcaaaagggctgt
cgatgtgttgaagtcgattgctgggatggagccgatggtcgcccaattgtctcacatggg
agaacgatgactaccagcgttctttttgcggattgtatctctgtcatcaacaaatatgcc
ttcctgtcatccgactaccctcttatcatctctctcgaggtccactgcaacccagagcaa
caactcgctatgactaacatcatcaaagataccttcaaggagaaattagttcttgagaca
ctgggagatgactggcctgtgctgcccagccctgaggccctgaagcatcgcgtccttatc
aaagtcaagacttccgaggaaataatcgacaccggcccggctactactgtaccaccagga
ctcgtcagcgccgggcgcaagcgtagctcaagctcccccttcatgcccccgaccgtcttg
gaagaccctcctcacagtctcccccctctctcctcgccacccacaatcagctcagctaat
gaacctgtgccccctcctctgggcagacgtgcctttacagcaacaagcgtctgcagcacc
tctgaagaaagcgacatcggccagagttcagccgcgatccagaaagagaagaaacgagct
caaaagagcagaattgtcaaggatcttgcagacctaggcgtttatacccgtgggtataaa
ttccatagtttcaactctgccgaaagcaaacttttcaaccacgtctattccttcgccgaa
cgagcattcgaaggcatttgtcgagattcagaaagtaaagctcttctcgaggcgcataat
agacgtttcttgactcgggtatacccttccggcttccgtgttcgatcatcaaacttcgat
ccaaacatcttctggcgtcgtagcgttcaaatggtcgctttgaactggcagacatatgat
gtcggaatgcaaatgaaccaagccatgtttgcatctgggaccgatcgcaccggatatgtt
ctcaaaccagaaagcttacgattgccgccaccttcatggaaaggccctggcctaaagcca
aaagtcgataggaaacttgtccggttctcaatagacgtgatctccgcccagcaactacct
cgcccgaagcaaatcggcctcgatgaaaacatcaatccctacgtcgaaattgaggttttc
agcgctgatgacaagactaagggcctcgcattcggtgaaggtggaatggacacgtctgat
cgtaacggtctatctggaatcggccaccctcaccgtcgcagaacaggtatcgagcaagga
aacgcttataatcccatcttcaacgaccagttcaagttctccctggaaaccaaatacccg
gatctcgtctttgtgcgctgggttgtctggcactctcctgatggcagaagcgtgggcaac
aacagcacccaactagctaccttcactgcgaagctgagcagcttggcccaagggttccgt
tacctacctctatacgacgggaatggcgaccaataccttttctccacgctattctgccga
gtgacgaagagcgaacttgcacctgtcattccgctgtttgataccgaggaaactaagaat
gaacgaaggggtatcctcaaacagctcggccagtccgtgctaaagagagccatatccacc
gaacgcgactcgccaaaggccaacattacctcaaacgaacagtcgtga

DBGET integrated database retrieval system