KEGG   Arthroderma benhamiae: ARB_06692Help
Entry
ARB_06692         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
abe  Arthroderma benhamiae
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    ARB_06692
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    ARB_06692
Enzymes [BR:abe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     ARB_06692
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1075 aa AA seqDB search
MNSPLSTSLDNPGPLDLPEGILSIPLHQSLTYPADAALVNAAPNTNNNTANNNNNNNNNS
IVSSNNNTNTTSNIKGPGLMRRISRGAANKLSRRRRSNSQDRRDKDSGPVTMLRRNNSKS
TTSASWDSALDSSYEEDESCDTLGTWCGPDSSKVKSDYQRSITSTASGVAPKVDPILQRG
CTLTKVNKLKKKPMTFYLDFDSGKMFWNLSNPTKRVYIDDIKEIRLRGDARMYREEHRIP
EEFENRWFTIIYNNSEGSKNRAVKTVHLIAPDEAMFELWTTTLENVARYRIGLMVGLTGS
VESEAILNAHWQREISRRASQDPRAMEEDSLDAEGIGNLCHSLHINCSKETIRILFARAD
TMGTGRVNFAQFREFFQLLKYRRDIKDLYNRLVTDDVQGMTLANFLDFVQYTQRENVQEN
RDYWVSIFEKFVRKARLRSQSQSDAPLPDDAPIRMSLDAFSAFLISSSNGIYPSHVPEPK
FDYPLNDYFISSSHNTYLLGRQVAGFSSTEAYVTALQKGCRCVEVDCWDGADGRPIVSHG
RTMTTSVLFADCISVINKYAFLSSDYPLIISLEVHCNPEQQLAMTNIIKDTFKEKLVLET
LGDDWPVLPSPEALKHRVLIKVKTSEEIIDTGPATTVPPGLVSAGRKRSSSSPFMPPTVL
EDPPHSLPPLSSPPTISSANEPVPPPLGRRAFTATSVCSTSEESDIGQSSAAIQKEKKRA
QKSRIVKDLADLGVYTRGYKFHSFNSAESKLFNHVYSFAERAFEGICRDSESKALLEAHN
RRFLTRVYPSGFRVRSSNFDPNIFWRRSVQMVALNWQTYDVGMQMNQAMFASGTDRTGYV
LKPESLRLPPPSWKGPGLKPKVDRKLVRFSIDVISAQQLPRPKQIGLDENINPYVEIEVF
SADDKTKGLAFGEGGMDTSDRNGLSGIGHPHRRRTGIEQGNAYNPIFNDQFKFSLETKYP
DLVFVRWVVWHSPDGRSVGNNSTQLATFTAKLSSLAQGFRYLPLYDGNGDQYLFSTLFCR
VTKSELAPVIPLFDTEETKNERRGILKQLGQSVLKRAISTERDSPKANITSNEQS
NT seq 3228 nt NT seq  +upstreamnt  +downstreamnt
atgaactcgcctttatctacctccctggataacccaggccctcttgacctccctgaagga
atactctctattccactccatcaaagcttgacgtatcccgctgatgctgcccttgtgaat
gccgcacccaataccaacaacaataccgccaacaacaacaacaacaacaacaacaatagc
attgtcagtagtaacaataatacaaataccaccagcaatatcaagggacccggcctgatg
agaagaatatcaaggggagccgccaacaagctttcccgacgacggcggtcgaactctcag
gatagacgcgacaaggactccggccctgtcaccatgctcaggcgcaacaatagcaagtca
acgacttcagcatcctgggatagcgctctagattcaagctacgaggaggatgagtcatgt
gataccctcgggacttggtgcggccctgacagcagcaaggtgaaaagcgactaccaacgg
tctattaccagtactgccagtggcgttgcccctaaggttgaccccatcctccagcgcggc
tgtaccctgaccaaggtaaacaagctgaagaagaaaccgatgactttttatcttgatttt
gactccgggaagatgttctggaacctgtcaaacccgaccaagcgggtatatattgatgat
attaaggagatacgactacgaggggatgctcggatgtacagagaggaacatcgtatcccc
gaggagttcgaaaaccggtggttcaccataatctacaataactccgagggttctaaaaac
cgagcggtcaagaccgtccatctaatcgcacccgatgaagctatgttcgagctctggacc
acgaccctggaaaatgttgcccgataccgcatcggcctcatggtaggcttgaccggttct
gtggagagcgaggccattctcaacgcccactggcaacgagagatatctagacgtgcttcc
caggaccctagggctatggaagaggacagtcttgatgcagaaggtatcggaaatttatgt
cacagtctgcacatcaactgctccaaggaaactatacgcatcctcttcgctcgggctgac
accatgggcactggaagagtcaactttgcgcaattcagggaattctttcaactgctcaaa
taccgccgagacattaaggatctgtacaatcgtctggttactgatgacgtacaaggtatg
accctggcaaactttctcgacttcgtccagtatacgcaacgcgaaaacgtccaggagaac
agggattactgggtttctatttttgaaaagttcgtccgcaaggctcgactgcgttcacag
agccagtcggatgcacctcttcctgatgatgcaccgatacgcatgagtctagatgccttc
tctgcgttcctgatatcgtcctccaacgggatctacccttcacatgttcctgagccaaaa
ttcgattacccactcaacgactacttcatttcaagttcacacaacacctatcttctggga
agacaagttgctggtttctctagcacagaagcgtatgtcactgcgcttcaaaagggctgt
cgatgtgttgaagtcgattgctgggatggagccgatggtcgcccaattgtctcacatggg
agaacgatgactaccagcgttctttttgcggattgtatctctgtcatcaacaaatatgcc
ttcctgtcatccgactaccctcttatcatctctctcgaggtccactgcaacccagagcaa
caactcgctatgactaacatcatcaaagataccttcaaggagaaattagttcttgagaca
ctgggagatgactggcctgtgctgcccagccctgaggccctgaagcatcgcgtccttatc
aaagtcaagacttccgaggaaataatcgacaccggcccggctactactgtaccaccagga
ctcgtcagcgccgggcgcaagcgtagctcaagctcccccttcatgcccccgaccgtcttg
gaagaccctcctcacagtctcccccctctctcctcgccacccacaatcagctcagctaat
gaacctgtgccccctcctctgggcagacgtgcctttacagcaacaagcgtctgcagcacc
tctgaagaaagcgacatcggccagagttcagccgcgatccagaaagagaagaaacgagct
caaaagagcagaattgtcaaggatcttgcagacctaggcgtttatacccgtgggtataaa
ttccatagtttcaactctgccgaaagcaaacttttcaaccacgtctattccttcgccgaa
cgagcattcgaaggcatttgtcgagattcagaaagtaaagctcttctcgaggcgcataat
agacgtttcttgactcgggtatacccttccggcttccgtgttcgatcatcaaacttcgat
ccaaacatcttctggcgtcgtagcgttcaaatggtcgctttgaactggcagacatatgat
gtcggaatgcaaatgaaccaagccatgtttgcatctgggaccgatcgcaccggatatgtt
ctcaaaccagaaagcttacgattgccgccaccttcatggaaaggccctggcctaaagcca
aaagtcgataggaaacttgtccggttctcaatagacgtgatctccgcccagcaactacct
cgcccgaagcaaatcggcctcgatgaaaacatcaatccctacgtcgaaattgaggttttc
agcgctgatgacaagactaagggcctcgcattcggtgaaggtggaatggacacgtctgat
cgtaacggtctatctggaatcggccaccctcaccgtcgcagaacaggtatcgagcaagga
aacgcttataatcccatcttcaacgaccagttcaagttctccctggaaaccaaatacccg
gatctcgtctttgtgcgctgggttgtctggcactctcctgatggcagaagcgtgggcaac
aacagcacccaactagctaccttcactgcgaagctgagcagcttggcccaagggttccgt
tacctacctctatacgacgggaatggcgaccaataccttttctccacgctattctgccga
gtgacgaagagcgaacttgcacctgtcattccgctgtttgataccgaggaaactaagaat
gaacgaaggggtatcctcaaacagctcggccagtccgtgctaaagagagccatatccacc
gaacgcgactcgccaaaggccaacattacctcaaacgaacagtcgtga

DBGET integrated database retrieval system