KEGG   Arthroderma benhamiae: ARB_06692Help
Entry
ARB_06692         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
abe  Arthroderma benhamiae
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:abe00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:abe04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1075 aa AA seqDB search
MNSPLSTSLDNPGPLDLPEGILSIPLHQSLTYPADAALVNAAPNTNNNTANNNNNNNNNS
IVSSNNNTNTTSNIKGPGLMRRISRGAANKLSRRRRSNSQDRRDKDSGPVTMLRRNNSKS
TTSASWDSALDSSYEEDESCDTLGTWCGPDSSKVKSDYQRSITSTASGVAPKVDPILQRG
CTLTKVNKLKKKPMTFYLDFDSGKMFWNLSNPTKRVYIDDIKEIRLRGDARMYREEHRIP
EEFENRWFTIIYNNSEGSKNRAVKTVHLIAPDEAMFELWTTTLENVARYRIGLMVGLTGS
VESEAILNAHWQREISRRASQDPRAMEEDSLDAEGIGNLCHSLHINCSKETIRILFARAD
TMGTGRVNFAQFREFFQLLKYRRDIKDLYNRLVTDDVQGMTLANFLDFVQYTQRENVQEN
RDYWVSIFEKFVRKARLRSQSQSDAPLPDDAPIRMSLDAFSAFLISSSNGIYPSHVPEPK
FDYPLNDYFISSSHNTYLLGRQVAGFSSTEAYVTALQKGCRCVEVDCWDGADGRPIVSHG
RTMTTSVLFADCISVINKYAFLSSDYPLIISLEVHCNPEQQLAMTNIIKDTFKEKLVLET
LGDDWPVLPSPEALKHRVLIKVKTSEEIIDTGPATTVPPGLVSAGRKRSSSSPFMPPTVL
EDPPHSLPPLSSPPTISSANEPVPPPLGRRAFTATSVCSTSEESDIGQSSAAIQKEKKRA
QKSRIVKDLADLGVYTRGYKFHSFNSAESKLFNHVYSFAERAFEGICRDSESKALLEAHN
RRFLTRVYPSGFRVRSSNFDPNIFWRRSVQMVALNWQTYDVGMQMNQAMFASGTDRTGYV
LKPESLRLPPPSWKGPGLKPKVDRKLVRFSIDVISAQQLPRPKQIGLDENINPYVEIEVF
SADDKTKGLAFGEGGMDTSDRNGLSGIGHPHRRRTGIEQGNAYNPIFNDQFKFSLETKYP
DLVFVRWVVWHSPDGRSVGNNSTQLATFTAKLSSLAQGFRYLPLYDGNGDQYLFSTLFCR
VTKSELAPVIPLFDTEETKNERRGILKQLGQSVLKRAISTERDSPKANITSNEQS
NT seq 3228 nt NT seq  +upstreamnt  +downstreamnt
atgaactcgcctttatctacctccctggataacccaggccctcttgacctccctgaagga
atactctctattccactccatcaaagcttgacgtatcccgctgatgctgcccttgtgaat
gccgcacccaataccaacaacaataccgccaacaacaacaacaacaacaacaacaatagc
attgtcagtagtaacaataatacaaataccaccagcaatatcaagggacccggcctgatg
agaagaatatcaaggggagccgccaacaagctttcccgacgacggcggtcgaactctcag
gatagacgcgacaaggactccggccctgtcaccatgctcaggcgcaacaatagcaagtca
acgacttcagcatcctgggatagcgctctagattcaagctacgaggaggatgagtcatgt
gataccctcgggacttggtgcggccctgacagcagcaaggtgaaaagcgactaccaacgg
tctattaccagtactgccagtggcgttgcccctaaggttgaccccatcctccagcgcggc
tgtaccctgaccaaggtaaacaagctgaagaagaaaccgatgactttttatcttgatttt
gactccgggaagatgttctggaacctgtcaaacccgaccaagcgggtatatattgatgat
attaaggagatacgactacgaggggatgctcggatgtacagagaggaacatcgtatcccc
gaggagttcgaaaaccggtggttcaccataatctacaataactccgagggttctaaaaac
cgagcggtcaagaccgtccatctaatcgcacccgatgaagctatgttcgagctctggacc
acgaccctggaaaatgttgcccgataccgcatcggcctcatggtaggcttgaccggttct
gtggagagcgaggccattctcaacgcccactggcaacgagagatatctagacgtgcttcc
caggaccctagggctatggaagaggacagtcttgatgcagaaggtatcggaaatttatgt
cacagtctgcacatcaactgctccaaggaaactatacgcatcctcttcgctcgggctgac
accatgggcactggaagagtcaactttgcgcaattcagggaattctttcaactgctcaaa
taccgccgagacattaaggatctgtacaatcgtctggttactgatgacgtacaaggtatg
accctggcaaactttctcgacttcgtccagtatacgcaacgcgaaaacgtccaggagaac
agggattactgggtttctatttttgaaaagttcgtccgcaaggctcgactgcgttcacag
agccagtcggatgcacctcttcctgatgatgcaccgatacgcatgagtctagatgccttc
tctgcgttcctgatatcgtcctccaacgggatctacccttcacatgttcctgagccaaaa
ttcgattacccactcaacgactacttcatttcaagttcacacaacacctatcttctggga
agacaagttgctggtttctctagcacagaagcgtatgtcactgcgcttcaaaagggctgt
cgatgtgttgaagtcgattgctgggatggagccgatggtcgcccaattgtctcacatggg
agaacgatgactaccagcgttctttttgcggattgtatctctgtcatcaacaaatatgcc
ttcctgtcatccgactaccctcttatcatctctctcgaggtccactgcaacccagagcaa
caactcgctatgactaacatcatcaaagataccttcaaggagaaattagttcttgagaca
ctgggagatgactggcctgtgctgcccagccctgaggccctgaagcatcgcgtccttatc
aaagtcaagacttccgaggaaataatcgacaccggcccggctactactgtaccaccagga
ctcgtcagcgccgggcgcaagcgtagctcaagctcccccttcatgcccccgaccgtcttg
gaagaccctcctcacagtctcccccctctctcctcgccacccacaatcagctcagctaat
gaacctgtgccccctcctctgggcagacgtgcctttacagcaacaagcgtctgcagcacc
tctgaagaaagcgacatcggccagagttcagccgcgatccagaaagagaagaaacgagct
caaaagagcagaattgtcaaggatcttgcagacctaggcgtttatacccgtgggtataaa
ttccatagtttcaactctgccgaaagcaaacttttcaaccacgtctattccttcgccgaa
cgagcattcgaaggcatttgtcgagattcagaaagtaaagctcttctcgaggcgcataat
agacgtttcttgactcgggtatacccttccggcttccgtgttcgatcatcaaacttcgat
ccaaacatcttctggcgtcgtagcgttcaaatggtcgctttgaactggcagacatatgat
gtcggaatgcaaatgaaccaagccatgtttgcatctgggaccgatcgcaccggatatgtt
ctcaaaccagaaagcttacgattgccgccaccttcatggaaaggccctggcctaaagcca
aaagtcgataggaaacttgtccggttctcaatagacgtgatctccgcccagcaactacct
cgcccgaagcaaatcggcctcgatgaaaacatcaatccctacgtcgaaattgaggttttc
agcgctgatgacaagactaagggcctcgcattcggtgaaggtggaatggacacgtctgat
cgtaacggtctatctggaatcggccaccctcaccgtcgcagaacaggtatcgagcaagga
aacgcttataatcccatcttcaacgaccagttcaagttctccctggaaaccaaatacccg
gatctcgtctttgtgcgctgggttgtctggcactctcctgatggcagaagcgtgggcaac
aacagcacccaactagctaccttcactgcgaagctgagcagcttggcccaagggttccgt
tacctacctctatacgacgggaatggcgaccaataccttttctccacgctattctgccga
gtgacgaagagcgaacttgcacctgtcattccgctgtttgataccgaggaaactaagaat
gaacgaaggggtatcctcaaacagctcggccagtccgtgctaaagagagccatatccacc
gaacgcgactcgccaaaggccaacattacctcaaacgaacagtcgtga

DBGET integrated database retrieval system