KEGG   Arthroderma benhamiae: ARB_06804Help
Entry
ARB_06804         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
abe  Arthroderma benhamiae
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ARB_06804
Enzymes [BR:abe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     ARB_06804
Glycosyltransferases [BR:abe01003]
 Polysaccharide
  Storage polysaccharide
   ARB_06804
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 651 aa AA seqDB search
MTERGIEIVYGRWLIEGAPRVLLIDTGAGYKYLDEWKGDLWNAAGIPSPSADSETNEAIA
FGYLVAWFLGELIFRQYICRDTERAVLAHFHEWLAGVALPLTKKRRMDVTTIFTTHATLL
GRYLCAGSVDFYNNLKNFDVDAEAGKRGIYHRYCIERAAAHSADVFTTVSHITAYESEHL
LKRKPDGVLPNGLNVKKFSAVHEFQNLHSHSKDKINDFVRGHFYGHNDFDLENTLYFFTS
GRYEYRNKGVDMFIESLARLNHRLKVSGSKTTVVAFIIMPSQTSSLTVEALKGQAVVKSL
RDTLESVEKSIGKRLFERCLGWKEGDNMPDEKDLMTNQDRVLIRRRLFAMKRHNLPPIVT
HNMLNDSEDPILNQLRRVQLFNYPTDRVKVVFHPEFLNSANPVLPLDYDDFVRGTNLGVF
PSYYEPWGYTPAECTVMGIPSITTNLAGFGCYMEELIENSADYGIYVVDRRLKGVDDSVN
QLTSYMFDFCQKSRRQRINQRNRTERLSDLLDWKRMGLEYVKARQLALRRAYPTSFDAAD
DFHEAIGHTEQKISRPLSVPGSPRDRTGTMTPGDFASIQEGREGLDTEDYISYKPPTSAN
GVNANTIPRAGSDDEEEDSIPVPIRPKRQSISLKLGPAPNGHGAGSETKAA
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcgtggcatagagatcgtatacggtcgatggctgatagaaggtgctccccgc
gtcctcctgattgatactggggcgggatataagtatctcgacgagtggaaaggagatctt
tggaacgctgctgggattccgtcaccttcggctgattcagagaccaacgaggcaattgca
tttggatatcttgttgcgtggtttctaggagagctgattttccggcagtatatatgtcga
gacaccgagagggctgttttagctcatttccatgagtggcttgcaggagttgccttgccc
ctgaccaagaagcggcggatggacgtaacgactatttttaccactcatgcaacgcttctt
ggacgatatctttgtgctggctcagttgacttctacaacaacttgaagaactttgacgtg
gatgcagaggccgggaagcgaggaatctaccaccgctactgcatcgagcgagctgctgcc
cattctgccgatgtcttcaccacggtctctcacattacagcctacgagagcgagcacttg
ctcaaacgaaagcccgacggagtcttgcccaatggattgaacgtcaagaaattctcggct
gttcatgagttccaaaacttgcactctcattcaaaggataagattaacgactttgtacgt
ggccatttctacggccacaacgactttgacctggaaaataccctatattttttcacctcc
ggccgatatgagtaccgaaataagggtgtggacatgtttattgaatcgctcgcgagactt
aatcaccggctgaaggtatctggatccaagactaccgtggtagcctttataattatgcct
tcccagacctcctctctcactgttgaggctcttaagggacaagctgtggtcaaatcgcta
cgagataccttggaaagcgtagaaaagagtatcgggaaacggctgttcgaacgctgtctg
ggctggaaagaaggtgacaacatgcctgacgaaaaggacctcatgacaaaccaggaccgt
gtgcttatccgccggcgtttgtttgccatgaaacggcacaaccttcctccaattgtcact
cataatatgctcaacgactctgaagatcccatccttaaccaacttcgccgagtccaactc
ttcaactaccctactgatcgcgtcaaggtggtcttccaccccgagttccttaactctgcg
aaccctgtgctgcctttggactacgacgattttgtccgtggtaccaaccttggtgttttc
ccttcatactatgagccatggggctatacccctgcagagtgcacggttatgggaatccca
agtataacaaccaaccttgctggttttggatgttatatggaagagctgatcgaaaactca
gccgattatggtatatatgtggttgacagacgattaaaaggcgttgacgactcggtaaac
caacttacgagctacatgttcgatttctgccagaagagcagaaggcagcgaatcaaccaa
agaaacagaacagaacgactgagtgatctactggattggaaacgcatgggcttggaatat
gtcaaggctcgccagctcgccctcagacgtgcgtaccctacctcctttgatgcagcagac
gatttccacgaggctatcggtcatacagaacaaaagatatctcgaccactatctgtccca
ggttctcctcgcgatcggacgggtaccatgaccccaggagactttgcttccatccaagaa
ggccgcgaagggctagataccgaggattatatatcctacaaacctccaaccagtgccaat
ggagttaatgctaacaccatacctagagccggcagtgatgatgaggaagaggattcgatc
cctgttcctattagaccgaaaaggcagtccatctccctcaaacttggcccagctcctaac
ggacatggagccggaagcgaaaccaaggctgcttga

DBGET integrated database retrieval system