KEGG   Arthroderma benhamiae: ARB_06859Help
Entry
ARB_06859         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
abe  Arthroderma benhamiae
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:abe00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    ARB_06859
Translation factors [BR:abe03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    ARB_06859
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 362 aa AA seqDB search
MENANLWTRRSNSAKLSLSTSGSDSKDGAGKSDSSRGRSAGRFDGSHPRSNPFNAISPLS
STVSSPSVAASSAFGLGSGAFASFGSTAKSSKTANSPDAIAGKQQGDKRDIQADQEGGAW
KPVKSKASSSSLDKSASSSNKDNGVRELPLKSTWIVWYRPPTPKYSDYEKSTIPLASISS
VESFWTVYSHLKRPSLLPTVSDYHIFKKNIRPVWEDEANKKGGKWIIRLKKGVADRYWED
LLLAMIGDQFAEASDEVCGAVLSVRSGEDVLSIWTKIDGGRNIKIRETIKRLLAFPPDTN
IIWKSHDDSIAQRSAIDQARLDKSSGNSGHHHHHHHNQGADRRRIANQEDSTGERGKNTA
NS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggagaacgctaatttatggactcgaagatctaactctgcaaaactctccttatcgacg
tccggctctgatagtaaagacggtgctggaaagtcggattcatctcgtggtcgctccgca
ggccgcttcgacggctcgcaccctcgctcaaacccattcaacgccatatcgcctctctct
tctacggtctcttccccctccgtggccgcatcatctgcctttgggctgggctcaggtgcc
ttcgcttcattcggatcgacggcgaagtcgtctaagaccgccaactcccctgacgctatc
gccggtaaacaacaaggtgataagcgagatatacaagctgaccaggaaggcggggcttgg
aaaccagtcaagtcaaaggcgtcttcgtcttctcttgacaagtccgcgtcttcgtccaac
aaggataacggagtaagggagcttccgctcaagtctacgtggatcgtctggtaccgtcct
ccgacacccaagtactctgattacgagaaatccactatccctctcgcctccatatcttcc
gtggagagcttttggaccgtttattcacaccttaaacgaccttccttgctaccgactgta
tcggactaccatatattcaagaaaaacattcgtcctgtatgggaggatgaggccaataaa
aagggcggcaagtggattatcagactgaagaagggagttgcggatcgatattgggaagat
ctgctcctggcaatgattggggatcagtttgctgaggcaagcgatgaggtctgcggcgcg
gtcctcagtgtcaggagtggggaggacgttctgagtatatggaccaagatcgatggtggc
cgcaacatcaagatcagggaaaccattaagcggcttcttgccttccccccagatacaaac
attatctggaaaagccatgatgacagcatagcacagagatcagctatagaccaagcgcgc
ctggataaatccagcggcaattccggtcaccaccaccatcatcaccacaatcaaggtgct
gaccgccgccgcatcgccaaccaggaagattccactggcgaaaggggtaagaataccgcg
aattcttaa

DBGET integrated database retrieval system