KEGG   Arthroderma benhamiae: ARB_06877Help
Entry
ARB_06877         CDS       T01611                                 

Definition
GTP cyclohydrolase I, putative
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
abe  Arthroderma benhamiae
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ARB_06877
Enzymes [BR:abe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     ARB_06877
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 315 aa AA seqDB search
MAPGDSQTLHPKPKSAVPSYLLNGTSSVRMPSSSRERESLNHSIKSSFERKHALGPDELR
DAAAIGDAASNTNAAASSTDENQVNGEETKPNGLKMVTDVAAQPQPQQKRSVSNHSRDQI
SPPSTAVSRPASPYTLNPPIDFDGLSWPNPEREGLLETPERYAKALMFFTKGYEENVRDL
VNGAVFHEDHDELVIVKDIEVFSLCEHHMVPFSGKMHIGYIPDRRVLGLSKLARLAEMFS
RRLQVQERLTKQVALAIVEVLKPQGVAVVMESSHLCMVMRGVQKTGSTTTTSCMLGCMRS
SAKTKEEFLSLLNRR
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggctccaggcgactcacagacgctgcatcccaagccgaagtctgcggtgccgtcgtac
ctgctgaacgggacttcttcggtgcgcatgccgagcagcagtcgggagcgagagagcctg
aaccactcgatcaagtcgtcgtttgaacggaaacacgccctggggccggacgagctcaga
gacgcggctgcgataggggatgctgcgtcgaatacaaacgcggcggcttccagcactgac
gagaaccaggtcaatggcgaggagacgaagcccaacgggctgaagatggtgacagatgtg
gccgcgcagccgcagccgcagcagaaacgcagcgtgagcaatcattctagagaccagata
tcgcctccgtcgactgccgtcagtcgccctgccagtccatatacgttgaatccaccgatc
gactttgacggactcagctggcctaatccggagcgggaaggcctgctcgagacgccagag
cgatatgccaaagctctgatgtttttcaccaaggggtacgaagaaaatgtacgagatctg
gtcaacggtgcagtattccatgaggatcacgatgagcttgtgattgtcaaggacatcgag
gtgttctccttgtgcgagcaccatatggttcctttctctggaaagatgcacattggctac
attccagaccgccgagttctcggtctttcgaaactggctcgtcttgcggaaatgttctct
cgtcggcttcaggttcaagaacgactaacaaagcaagtcgctctcgccattgttgaggtc
ctcaagcctcaaggcgttgccgtagtcatggaatcaagccatctctgcatggtcatgcgt
ggtgtccaaaagacgggcagtactaccaccaccagctgcatgcttggttgcatgaggtcg
agcgcaaagaccaaggaagagttcctcagcctgttgaacaggagataa

DBGET integrated database retrieval system