KEGG   Arthroderma benhamiae: ARB_06956Help
Entry
ARB_06956         CDS       T01611                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
abe  Arthroderma benhamiae
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ARB_06956
Enzymes [BR:abe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     ARB_06956
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 371 aa AA seqDB search
MAPSIRVIGSLNVDMVSVTPRFPGPGETLTATSFTTSPGGKGANQAVACGRLSRSRTSSS
SSPSDVLANVEMVGAVGRLDAHFGTLLQPTLANSGVSTDRVRRIDDEHTGVAVIIVDTSA
AGENRILFSPNANYSGMKPTDEVISQSLSTPLPDLIVLQAEIPIDTVIGILRGVAAKKKL
QESDVEVVFNPAPAPEGGLPDDVYAAVDHLIMNETECELMAPEELRDSSLSQEEQRNKIA
VHFHALGVRYVIVTLGAKGVWYSAAEPGKVAQQDAGRWIRSVNEVPASRVDRVVDTTAAG
DTFVGGYCVQIAQWREQRRAAGKACSALTTDEWKDRYGIVTEEAVRCGTRASAQCVQRSG
AMDSIPFRDEI
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggctccgtcgattcgagttatcggttcgctgaacgtggacatggtctccgtgaccccc
cggttccccggccccggagagacactgacggcaacatcctttacgaccagcccaggaggc
aaaggagccaaccaagccgttgcctgtggtcgactttctcgatcccgaacttcctcctcc
tcttctccctcggatgtgctggccaacgtcgagatggtcggcgcagtcggccggttagac
gcacacttcggcacattgctacaacctacactcgccaactccggagttagcacagaccga
gtacggaggatagacgatgaacacacaggcgtagctgtgattattgttgacacatctgct
gctggcgagaatagaatactgttttcacccaatgccaactactctggaatgaaacctacg
gatgaagtgatttcgcagtcactgtcgactcctctgccagaccttattgtcctgcaggcg
gaaatccctattgatacggttattggtattctgagaggagtagctgctaagaagaaactt
caagaaagtgatgttgaagtggtattcaaccctgctcccgcacccgaaggcgggctaccg
gacgatgtatatgcagccgttgaccatttgatcatgaacgagacggagtgtgagttgatg
gcacccgaggaattacgagatagtagcctctctcaagaagaacagaggaacaaaattgct
gttcacttccatgcccttggggtgcgatatgtgattgtcacactcggagccaagggggta
tggtatagtgccgccgagcctggtaaggttgctcagcaggatgcgggcaggtggattagg
tctgtcaacgaggttcctgcctcaagggtggacagggttgttgatactacggctgcgggt
gatacgttcgttggcggatactgtgttcagattgcacagtggagggaacagaggagggcg
gcgggaaaggcttgctcggctcttacaacagatgaatggaaggataggtatggaattgtg
acagaggaagctgttagatgtggtacaagggcctctgctcaatgcgtccagcgatctggg
gcaatggatagcatcccattcagggatgagatttag

DBGET integrated database retrieval system