KEGG   Arthroderma benhamiae: ARB_07003Help
Entry
ARB_07003         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
abe  Arthroderma benhamiae
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    ARB_07003
Enzymes [BR:abe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     ARB_07003
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 973 aa AA seqDB search
MAHHDDVDVKTESVADAVTDMKLEREDSEEGVSLNGKASSNGEANGTPATPAKSAASSPP
DRPSSALKDEESEEKVGGDITVKQEPGQPPKLARSATKKVVPRKPQMFDHLPDSTAEATA
LFQVIDACTYSNKNMGYTDHAMECDCAEEWNPKTGINEACGEDSDCINRATKMECVDNCG
CGDNCQNQRFQKRQYADVTVIKTEKKGFGLRANTDLRPNDFIYEYIGEVINEPQFRKRMM
QYDDEGIKHFYFMSLNKGEFVDATRKGNLGRFCNHSCNPNCYIDKWVVGEKLRMGIFAEK
HIKAGEELVFNYNVDRYGADPQPCYCGEANCLGYIGGKTQTERATKLSNATIEALGIDDL
DSWDTALPKRPKKKKTAEDDEEYVDRFQPKSLDEEGVTKVMATLMQCKEKWIAVKLLGRM
QRCDDERVINRIVRMHGYQILNSQLSAWKEDFNVVLQILQILDKFPRLTRNKIIDSKIET
TVKPLTECGEERVEKQAASLLETWSALEVGYRIPRMKRDPALTANIPSAKQFERREVMRE
REDRPRKSASESRDKSPKSPSVDPTRVAPRGPAAHGRGGKSHRNSYHQGPRPFRRPFNPL
PSGWFAAEANGKTYYYSARGDTTWVRPTAPAPQPPPPPKPESKDKTLQDIIDGIMNSKED
TPKSKDKEVSATPATPADVPQKKEHKPKWKSLSEEKQKKIYENTLFPHVKYVVDKFKNKL
PKDDLKRYAKEVAKKLVNSDFKNNRVTDPTKVSEKQIKQVKKFCKEYFEKAVVKHQAYEK
KKAEHKRKHSKPSGSISNSKEPAIPPPTDKADESDAADDDVNLSDNDEPIQDDVQCSSPR
EDESMTPGGSLKRKRDIDETVEEEDNDTKHDGSSLSKRQRSESPPVPPPPPPPMSPDNSM
EVDDIDGGFKRKMDEEFELEDENTPCSRSPGKYNSHGSSPPPFPPPPPLPADMPDRSIDP
YRNEQSNMDDETP
NT seq 2922 nt NT seq  +upstreamnt  +downstreamnt
atggctcaccacgatgatgttgatgtgaagacagaatcggtggcagacgcggtaacagac
atgaagctggagcgagaggactcggaagagggtgtgtccctcaacggcaaggcctctagc
aacggggaggccaacggcactcccgccacacctgccaagtcagcagcttcgtctcctcca
gataggccgtcttctgccctgaaagatgaggaatccgaagaaaaggttggaggggatatc
accgtcaagcaagaaccaggccaacctcccaagctggctcgttctgctaccaagaaagtt
gtccccaggaaacctcagatgttcgaccatctccctgacagcactgcagaggctactgct
cttttccaggtgatagatgcatgcacatattcgaataagaatatgggctacacggaccat
gctatggaatgtgactgtgctgaagagtggaatcccaagacaggaataaacgaggcctgt
ggggaagattcagactgcataaacagagctacaaagatggaatgtgttgataattgcggc
tgtggtgacaactgccagaatcaacgctttcaaaaacgacagtatgccgatgtgacagtt
attaaaacagagaaaaagggatttggtctacgagcaaacaccgatctgcgacccaacgac
tttatctacgaatatattggcgaagtcatcaatgaaccgcagtttcggaaacgtatgatg
cagtatgacgatgagggtatcaaacatttctatttcatgtccctcaacaagggcgaattc
gtcgatgcaacaaggaaaggaaacctaggccgcttctgcaatcattcctgcaatccaaac
tgctacatcgacaaatgggtcgttggagaaaagcttcgcatgggcatatttgctgagaaa
cacatcaaagccggcgaagaattagtcttcaactacaacgttgaccgctatggtgctgat
ccacagccatgctattgtggcgaagctaactgccttggctatattggtgggaagacacag
acagaacgagcaacgaagctatcgaatgccaccattgaggcattgggaattgatgatctg
gatagctgggataccgctcttccaaaacggcccaaaaagaagaagaccgctgaagacgac
gaagaatatgtcgaccgattccaacccaagtcgctggatgaagagggtgtcacgaaggtt
atggcaactctcatgcaatgcaaagagaaatggattgctgtaaagctcttgggccgtatg
cagcgctgtgacgatgaacgggtcatcaacagaattgtgaggatgcatggttaccagatt
ctcaattcccagcttagtgcttggaaagaagacttcaacgtcgtgctgcaaattctccaa
atcttggataaattcccacggcttacacgaaataagatcattgactccaaaattgagacc
actgttaagccattgaccgagtgtggtgaagagcgcgttgaaaagcaagctgcttcgcta
ctcgagacttggtcggcgctggaagttggttaccgaattcctagaatgaagagagaccct
gcacttacagccaatataccttccgcaaaacaattcgagcgtcgagaagtaatgcgtgag
cgtgaagatcgccctcgaaaatcagcgtctgagtctcgggataaatctccaaaatcacct
tcggttgatcctaccagagtcgcccctcgaggccccgcagcacatggtaggggtggaaag
agccacaggaattcataccaccaaggcccacgaccgttccgtcgaccgtttaacccgctc
ccttcaggatggttcgctgcagaagctaatgggaaaacatactactactctgctcgggga
gatactacttgggtgagaccaacagcacctgcgccacaaccaccacccccgccgaagccc
gagtcaaaggataagacattgcaagacattatcgatgggataatgaattcaaaagaggat
accccgaaatctaaggataaagaagtatccgctactccagcaactcccgctgatgttcct
caaaagaaggaacataaaccaaaatggaaatcattaagtgaagagaagcagaagaagatc
tatgaaaacacactctttcctcatgtcaagtacgttgtggataaatttaaaaataagctt
cccaaggatgacctgaagcgctatgcaaaggaggttgccaaaaagcttgtgaactctgat
ttcaaaaataaccgtgtgactgatcctactaaagtcagtgagaagcaaataaagcaagtg
aagaagttctgcaaagaatacttcgagaaggcggttgtgaagcaccaagcctacgagaag
aagaaagcagaacacaaaagaaaacacagcaagccgtcgggcagcatttctaattctaag
gagccggccatcccacctcctactgacaaagctgatgagagtgatgctgctgatgatgat
gtcaacttgtcggacaatgatgagcctatccaagatgatgtccaatgttcgtcacctagg
gaagatgaatcaatgacaccaggggggagcctaaagagaaaacgtgacattgatgagaca
gttgaagaagaggataacgacaccaaacacgatggttcctcgttatcgaaacggcagcgt
tccgaatccccacctgttccaccacctcctccacccccgatgagtcctgataactcaatg
gaagtagatgacatagacgggggtttcaagagaaagatggacgaagaatttgaacttgag
gatgaaaataccccttgctcaaggtcaccgggaaagtacaattcccatggatcatcgccc
ccaccttttcctccccctcctccattgccagccgatatgcctgatcggagcatcgatcca
tacagaaatgagcaaagcaacatggatgacgaaaccccctga

DBGET integrated database retrieval system