KEGG   Arthroderma benhamiae: ARB_07158Help
Entry
ARB_07158         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
abe  Arthroderma benhamiae
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:abe00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    ARB_07158
Translation factors [BR:abe03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    ARB_07158
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 879 aa AA seqDB search
MKQNNFFLDPALLVIALQICSPSPASLLRTICRLRQCPHRRRLSVLLALYMLRVDCIDGT
CSYRAALVPMWNGPHNVLLQLFFVHIKKNTRFLPPPRTSPSPCFASQLVPLPLARRQIAT
MSTFDTLTEQDLQQDEVEIDFSGMPAHIPPPKKTLVEEAELTAVVRLEEGLDTFVVFDGL
PIVSEDNKAKLIKFLLKKIKKDGPSSSNIDPNRQIFLPMNENGMSEGFAFVEYDTPEEAF
AAIKSLHGTPLDKKHTLAVNKLTDIDRYGREGRIDDEYKPPKIEPFQEKEHLRSWLGDPN
ARDQFAMYRGDKVGVFWNMKKDPPENVVDRDHWTQLFVQWSPMGTYLASVHPQGIQLWGG
PQFSKQKQFPHPFVQLVEFSPQENYLTTWSSRPIQIEGAPGVLSYDEDGKNIIIWDITTG
KPLRSFVSHDLTAPAGADDAAAQKKKVQWPAFKWSADEKYVARMLQHQSISVYELPRMNL
LDKTVVKIEGVMDFEWSPATVQREGVKRYEQLFSFWTPEIGSNPAKVGLMSIPSKEIVRT
RNLFNVSDVKLHWQSQGAYVCVKVDRHSKSKKSMATNLEIFRVKEKGVPVEVVDSLKDTV
INFAWEPKGDRFVLITTGEAIAGSAVAPKTAVSFFCPEKVKGGAIGNFKLIRTIEKKTSN
GIYWSPKGRFVVVATVHSQQNFDLDFWDLDFEGEKPESEKDLSANLQLMKTVDHFGVTDV
DWDPTGRYVVSSASAWTHSLENGYNIHTFSGTTLAEHPTEKFKQLLWRPRPPTFLSKEEQ
KQVRKNLREYSREFDEEDKYAVDIANTAIVEMRKRVLSEWTAWLRKEKQMILEEREDLGL
SPNPDDDIVAQPNITAAEGDTVVEEIVEEIIEETEEIIS
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagaacaacttcttcttagacccagcactgctagttatcgcccttcaaatttgc
tctccgtctccagcttctctactccgtactatctgccgtcttcgtcaatgccctcatcgt
cgccgtctgtctgtgttgctggctctttatatgctgcgagtcgactgcatcgacggaact
tgcagttaccgtgctgcgctagtcccgatgtggaatggcccacacaacgttcttttgcag
ctttttttcgtccacataaaaaaaaataccagatttcttcctccaccacgaacttcgccg
tcgccttgctttgccagtcaacttgtcccgctgccgcttgcgagacgccagatcgccacg
atgtcgacgttcgataccttgaccgagcaggacctgcagcaggatgaagtcgagatcgat
ttctcaggcatgcccgcacacatcccacccccaaaaaagaccctagtggaagaagctgaa
ctaacagctgttgtccgactggaagaaggactcgataccttcgtcgttttcgacggactc
ccaatcgtctccgaagataataaggcgaagttgattaagtttttgttgaagaaaataaag
aaggatggcccctcatccagcaatatcgacccgaaccgccagatttttctacccatgaat
gagaatggaatgtccgaaggtttcgcttttgttgaatatgacacccccgaggaagccttt
gccgccataaagagtcttcacggaacccctctagataagaagcacaccctagcagtcaac
aagctcactgatatagaccgatatggacgtgaaggccggatagacgacgaatacaaacct
cccaagatcgaaccgttccaggaaaaggagcaccttcgatcatggctgggcgatcccaat
gcccgcgatcagttcgcaatgtaccgcggtgacaaagttggtgtgttttggaatatgaag
aaggaccctccagagaatgttgtcgaccgagatcactggacccagctttttgtacagtgg
tctcctatgggtacatacctcgcttccgtacatccacaaggtatccaactctggggaggt
ccccaattcagcaaacaaaaacagttccctcatcctttcgtccagcttgtggagttctct
ccccaggaaaactaccttaccacatggtctagccgcccgatacaaatagagggagcacct
ggtgttttgtcatatgatgaagacggcaagaatataatcatctgggatattaccaccgga
aagcctctccgatccttcgtcagccatgacctgactgcccccgccggcgccgatgacgct
gctgctcaaaagaagaaagtacagtggcctgcgtttaaatggtcagcggatgagaaatat
gttgctcgtatgcttcagcaccagtccatatctgtctacgagctacctcgtatgaacctt
cttgacaagaccgtagtcaagattgaaggtgttatggatttcgaatggtcccctgctact
gtacaaagggaaggtgtcaaacgctatgagcagcttttcagcttttggactcctgaaatt
ggaagcaaccctgctaaggttggtttgatgagcataccctcaaaggagatcgttcgtaca
cgaaatcttttcaatgtctccgatgtgaagctacactggcaatcccagggtgcctacgtt
tgcgtcaaagttgacaggcactccaagtccaagaaatccatggctactaacctggagatc
ttccgagtgaaagaaaagggcgtgccagtcgaggttgtcgactcactaaaggataccgtc
ataaattttgcttgggaacccaagggtgatcgatttgtcctcatcacaactggcgaggcc
atcgcgggctctgctgttgctccaaagactgccgtctctttcttttgccccgagaaagtt
aaaggtggcgctatcggtaacttcaaactcatccgcaccattgagaagaagacaagcaat
ggaatctactggtctcccaagggccgattcgttgtcgtcgctaccgtgcattcacagcaa
aactttgaccttgatttctgggacctggactttgagggtgagaagccagagagtgagaaa
gatctttcggccaatctacagctcatgaagactgtcgaccactttggtgtgactgatgtc
gactgggacccaactggtagatacgttgtctccagcgcctctgcctggacgcactcgctt
gaaaacggctacaatattcacaccttctccggtacaacattagcagaacaccccactgag
aagttcaagcaactcctctggcgcccgcgacctccaacattcctttcaaaggaagagcaa
aaacaagtccgcaagaacctccgcgaatactctcgcgaatttgacgaagaagacaagtac
gccgtcgatattgccaacaccgccatagtcgagatgagaaagagagtcctcagtgaatgg
accgcctggctcagaaaggagaagcaaatgattctcgaggaaagagaagatctcggtctg
tctccgaacccagatgatgacatcgttgctcaacccaatatcactgccgctgagggcgat
acagtggtagaggagattgtcgaggagatcatcgaagaaactgaagagatcattagctaa

DBGET integrated database retrieval system