KEGG   Arthroderma benhamiae: ARB_07179Help
Entry
ARB_07179         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
abe  Arthroderma benhamiae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:abe00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1506 aa AA seqDB search
MDSNNQELVYVVHLNDNGSPDAHHSYVNLPPPTTPAYSLRLQFEGSSPLCRYGSLWVNIP
SAGEEFQRDKYREYKLKPDFNKDIHVDIPIAISGAFDYYFTYRQLPKLFGPGSGSDTGKE
TRSETYYLNVRPAITLKGKALPLESLSIFSVVSKFMGEYPTDWNKHLRGIGERGYNVVHF
TPLVKRGASNSPYSLYDQLEFEECFSNGQKDVADMTAKMEKDYGLLALTDVVWNHVAHNS
QLLEDHPEVGYNIKNAPWLEAALELDTALLQYGNDLAKLGLPTEFKTEDDILVVLRRARE
NVIDKIKLWEFYAIDVERDAAAALKSWESDNYEDAELGNAEEIRGWSMEKKAKFLRQKGV
TNANRVLGRYDRKADPNITASFLAAMFGRHAESKADASTVKAELRKLLDAVNLPLFKEYD
KDVITILDQLFGRIKYLRVDEHGPKMGPVSNESPLIETYFTRLSSSGKRDPRLLALANNG
WVWNADAMKDNAGPDSRAYLLREVIVWGDCVKLNYGASRDDNPFLWDYMADYSKLMAKYF
MGFRIDNCHSTPIPVAEYLLDEARRVRPNLVVFAELFTGSEKTDYIFAKRLGLTGLIREA
MQAWSAGELSRLVHRHGGRPIGSFEADLLSHGDHRESNQIVRQLQYTPLNALFMDCTHDN
QMPAQKREARDTLPNAALVAMCSSAIGSVMGYDEIYPKHVDLVNETRLYSSASSDGEVKS
RTGQGGIGGIKRLLNDLHTSMAVNCYDETHIHHEGQYITVHRVQPHTRKGVLLIAHTAFS
GSKDEHNLDPIVLSGTNAKMIGAWKLEIISSNRDANTNTRFINGLHSKVSDIEEVSIEND
GNNTIIRVPAGLVPGSIALLETWLPETNLLKDLSTFITSDAEAAFKSLDPVDLNFVLYKC
NPEERDISHGSDGVYDIPNFGPLVYAGLQGWWSVLEGVIRNNDVGHPICDNLRNGQWALD
FIVRRMHKAASNEGYGRLKEPAEWLQGRFDAIRKLPSFLLPRYFAIVVKTAYEAALARGI
QLLGVTIEHGKDIIHELAMVSIQQVGFVNSASLYPTKRVPCLAAGLPHFSTDWARCWGRD
VFISLRGLLLCTGRFDEAKEHILAFASVLKHGLMPNLLSDGKAPRYNARDAVWFFLQAIQ
DYTKIVPDGIQVLNEKVRRRFLPYDDTWFSHDDSRAYSETSTVAEIIQEIFQRHASGISF
REYNAGPNLDMQMKDEGFQIDIRVDWETGLVFGGNQWNCGTWMDKMGESTKSGNKGHPGT
PRDGAAVEISGLLYSTLSWLSSLADQGKFPFKGVEVGSGESISYAEWAAKIKSNFERCYY
IPENQVDDSKYDIDSKIVHRRGIYKDLYRSGKPYEDYQFRPNFAVAMTVAPELFTLEKAL
RTLELADSVLRGPMGMATLDPKDLNYNPYYVNSEDSTNFATSKGRNYHQGPEWLWPTGYF
LRALMKFVLMRRDSPQDRTDIFQQLTNRLEECKKALRTSPWRGLTELTNKNGELCADSVS
CCFLSP
NT seq 4521 nt NT seq  +upstreamnt  +downstreamnt
atggactcgaataaccaagagctggtgtacgtggtgcacctgaacgacaatggctccccg
gacgcccatcacagctacgtcaacctgcccccgccgacgactccggcgtacagtctccgc
ctgcagttcgagggcagcagtccgctgtgtcgatatgggagcctatgggtgaatatccct
tctgcaggcgaggagtttcagcgggacaagtaccgcgagtacaagctgaagccggacttc
aacaaagacatccacgttgatattcccatcgctatctccggtgctttcgattactacttc
acttaccgtcagctacccaagctctttgggccggggtctggctctgatactgggaaggag
acccggtctgagacgtactatctcaatgtccgcccggccatcactctcaagggcaaagcc
ctgccgctagaatcgctatctatattttctgtggtgtccaagttcatgggagagtatcca
acagactggaacaaacacttgcgtgggattggagagagggggtacaatgttgtccatttt
actcctctcgtgaagcgaggggcttcaaactcgccgtatagcctttacgaccaactcgag
tttgaagaatgtttctccaatggacagaaggatgtggctgacatgacggcgaagatggag
aaggactatgggcttctggcactgacggatgttgtttggaatcatgttgcacataacagc
caactccttgaagaccacccagaggtagggtataatatcaagaatgctccatggcttgaa
gctgcattagaactagacacggctttattgcagtatggaaatgaccttgcgaagctggga
ttgcctacagaattcaagacagaggatgatatcttggtagtgctacgcagagcacgggaa
aacgtcattgacaagataaagctctgggagttttatgctattgatgttgaaagagacgct
gcggcagcactaaaatcatgggaatcagacaattatgaggatgctgagcttggaaatgca
gaagagattcgaggatggtcaatggagaagaaggcaaagttccttcgtcagaaaggggta
acaaatgccaaccgagttctaggacgatatgatcggaaagcggacccaaatataaccgct
tctttccttgcagccatgtttggaagacatgctgagtccaaggctgatgcatcgactgtc
aaggctgaactccgaaagcttcttgatgctgttaaccttcccttgttcaaggaatatgac
aaggatgtcataactattcttgaccagctctttggccggataaaataccttcgagttgat
gaacatggtccaaaaatggggcctgtgagcaatgaaagcccgcttatagagacttatttc
accaggctttcttcgagtggcaagagagaccccaggttgcttgctctggcgaacaacggg
tgggtatggaatgcggatgcaatgaaagacaatgcaggtccggactctcgtgcatatctg
ttgcgagaggttattgtctggggcgactgtgtcaagttaaactatggagcatcccgagac
gataatccttttttatgggactatatggcggattactccaagttaatggccaagtacttc
atgggcttccgcattgataactgccattcaacccccattccggtagccgaatatctcctt
gacgaagctagaagagtgcggcccaatctagttgtcttcgcagagctctttaccggatct
gagaaaaccgattatatatttgctaaaagacttggtctgacagggttgattcgcgaggct
atgcaggcttggagtgctggcgaacttagtcgactcgttcatcgtcatggaggacggccg
attggtagctttgaggcagatctgttatctcacggtgaccatcgggaatccaaccagatc
gttaggcagctgcaatatacgcctctaaatgcccttttcatggactgtacgcacgacaat
caaatgcctgctcagaaacgtgaagcgagagataccctccctaacgctgcattggttgcc
atgtgttcatctgcaatcggtagtgtgatgggatatgatgagatttaccccaaacacgtc
gacttggttaacgagacacgcctgtattcgtctgcttcctctgacggtgaagtgaagtct
aggacaggccaaggaggtatcggtggaataaaaaggttactgaacgaccttcacaccagc
atggctgtgaattgctatgatgaaacccatattcaccatgagggccagtatataacggtc
catcgtgtccagccacacacaaggaagggtgttttgctcattgcccataccgctttctct
ggctccaaggatgaacacaacctggatccgattgttctgtccggaactaatgctaagatg
ataggtgcctggaaattggagataatctcctccaaccgcgatgcaaatacgaatacaagg
ttcataaacggacttcatagcaaggtttccgatattgaagaagtcagcattgagaacgat
ggtaataacactattattcgtgtaccagcaggccttgtccctgggtctattgcactcctg
gagacctggttgccagaaacaaatctgctgaaagatctgagtactttcatcacgtctgat
gccgaagctgcgttcaaatccctagatcctgtcgatttaaacttcgttctgtacaaatgc
aatcctgaagaaagagacattagccatgggtcggatggagtgtatgacattccaaacttt
ggcccactagtatacgccgggctccagggatggtggagtgttcttgagggagttattcga
aataacgacgtgggtcatcctatatgcgataaccttcggaatggacagtgggctctcgac
tttatcgtccgcagaatgcacaaagcggcttccaatgaaggatacggacgactgaaggaa
ccggcggaatggcttcagggtcgttttgatgccatcagaaagctaccttcctttttgttg
ccacgctatttcgccatcgttgtcaaaacggcgtatgaagctgctttagcccgaggtatc
cagctccttggtgttactattgagcatggtaaggatatcattcatgaacttgcaatggtt
agcatacagcaagtaggcttcgtcaattccgcatcactgtacccaaccaagcgtgtacct
tgtctcgccgctggtctgcctcatttctcaacagactgggcgagatgctgggggagggat
gtttttatctctttgcgtggtctcctcttgtgtactgggagatttgacgaagcgaaagag
catatccttgcattcgcgagcgtgttgaagcatgggctcatgcctaacctgctttcagat
ggaaaggcaccgcgatataatgcccgtgatgcggtatggttcttcctgcaggctatccaa
gactataccaagattgtgccagatggaatccaggtattgaatgagaaagtccgtcgtcga
ttcttgccatatgacgatacatggttctcccatgacgatagccgtgcatatagtgaaacc
tcaactgtggctgagatcatccaggagatatttcaacgccatgcttcgggtatctcattc
cgtgagtacaacgcaggtcctaaccttgatatgcagatgaaggatgagggtttccagatt
gatattcgtgttgactgggaaactggtctggtattcggaggaaaccaatggaattgtggt
acatggatggataagatgggcgaaagtaccaagagcggaaataagggtcatccaggaact
cctcgggacggtgcagctgttgaaatcagtggactgctctatagcactctctcatggttg
tcgagtctcgcagaccaggggaaattcccattcaaaggcgttgaagttggctctggagaa
tcaatttcttatgcagaatgggctgcgaagattaagtccaactttgagaggtgctattac
atccccgaaaaccaggttgacgatagcaaatacgacatcgatagcaagatcgttcatcga
cgcggtatttataaagatctctatcgatccggtaagccgtatgaggattatcagttccga
cccaactttgctgttgccatgactgttgcccccgaattattcacgctggagaaagcactc
cgtacgctcgaattggccgatagcgtcctccgtggacccatgggtatggcgacgctggat
cccaaggatctcaactacaacccatactatgtgaattctgaagattccaccaacttcgca
acttcaaagggaagaaactaccaccaaggaccagaatggctgtggcccactgggtatttc
ctgagggccttgatgaagtttgtcctgatgcgacgggacagtccccaggaccgcacggat
atattccagcaacttacaaatcggctggaagaatgcaaaaaggcacttcgcactagccct
tggagggggctgaccgaactaacaaataagaatggcgagttgtgtgcagactcggtgagc
tgttgctttctctccccctga

DBGET integrated database retrieval system