KEGG   Arthroderma benhamiae: ARB_07290Help
Entry
ARB_07290         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
abe  Arthroderma benhamiae
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:abe00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 941 aa AA seqDB search
MASKASNAGLEAKTPSKSRSKSRSKSRSPGPKGASRQSKTHDYRSDGVKDYDVLNLPVSD
YKIMLVITAIATVVRLFRIYQPSSVVFDEVHFGGFATKYIKGKFFMDVHPPLAKLLITLA
GHLAGFKGDFDFKEIGKDYLEPGVPYVAMRMLPAIMGIMTVPTMFLTLKATGCRTSTASF
GALLVTFENALVTQSRFILLDSPLIIFTALTVLSFVSFSNQHEQGPPKAFGCSWWFWLVA
SGLFLGATASVKWVGLFTIAWVGSLTLVQLWVLLGDSKTVTPHLWFKHFFARALCLIVIP
VGLYMAMFGIHFLCLRNPGEGDGFMSSEFQATLNSKGMSDTPVDVVFGSRVSIRHHNTQG
GYLHSHSHMYPGGSKQQQITLYPHKDDNNIFILENQTQPLGPYGQVPGPRAWDNITTEHI
IDGSTIRLYHMTTDRRLHSHDVRPPVTEADWQQEVSAYGYEGFEGDANDLFRVEIVPSMS
DGAEAKKRLRTIQTKFKLVHVMTGCVLFSHKVKLPEWGFDQQEVTCAKGGSLPNSIWYIE
QNSQPALPDDVEKVNYKIPNFFAKFWELHKVMWRTNAGLVNSHAWDSRPPSWPILSRGIN
FWGRHHRHVYLIGNPVIWWTSTAALVIWVLFKGIAVLRWQRGFKDYNYVHFKRFDYEIGQ
TLLGWALHYFPFYLMARQLFLHHYLPALYFAILAFCQIYDFVANRFNKPSIFGKLFTVAF
LSLSVAAFCILSPLAYGNPWTKDMCQRTKLIPTWDFDCNLFHNDLSQYAIPEVVNTSEAA
HTSIAAPPVQQQQQQQPGEQEQEQQPEQQENQVPVQPESPQQPPAVDPELRKVREVEYRD
SEGNILSEEQVKVLQEQGEISFETRYETRTRVIDTEGRELPKEAIIAPEHPDVQGANPET
VAKDEPKAPANKPAEVKGENESPKKKENKPKPASEAKAATN
NT seq 2826 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaaggcctcgaatgccggtctggaggcaaagacgcccagcaaaagccgctcg
aagagccgttcgaagagcagatcccctggccccaagggcgcctccaggcagtcgaaaacc
cacgattaccgctccgatggcgtcaaggactatgatgtcctcaacctgcccgtctcagac
tacaagataatgctcgttatcactgcaattgcaacggtggtgcggctgttcaggatctac
cagccgtccagcgtcgtctttgacgaggtccacttcggaggcttcgctaccaagtatatc
aagggcaaattcttcatggacgtccacccgccgctagctaaactgcttatcaccctcgct
ggtcacctcgctgggttcaagggagattttgacttcaaggaaattggcaaggattatcta
gaacctggtgttccctacgttgccatgcgcatgctccccgctatcatgggtataatgacc
gtccctaccatgtttcttactctgaaagcaaccggctgtcggacttcaaccgcctcgttc
ggtgctctcctagtcacctttgaaaatgcactcgtcacccaatcgcgcttcattcttttg
gactctcctctgatcatcttcactgccttgaccgtcctctctttcgtctcgttctccaac
cagcacgaacaaggcccaccaaaggcctttggatgctcttggtggttctggctagtggca
tccggactcttccttggagcaactgctagtgtgaaatgggttggcctcttcacgattgcg
tgggttggatcattgactctcgtccaactctgggttcttctcggtgattcaaagactgtt
actccacacctctggtttaaacacttctttgctcgtgccctctgcctgattgtcatccct
gttggcctctacatggccatgttcggaattcacttcctctgtctccgaaaccccggtgaa
ggtgatggcttcatgtcatccgaattccaagcaactctcaactcaaagggcatgagtgat
actcccgtcgatgttgtctttggctctagggtatctatcagacaccacaatactcaggga
ggctacctccactcgcacagccacatgtaccccggcggaagcaagcagcaacaaatcacc
ctttacccccacaaggacgacaacaacatcttcatcctcgagaaccagactcagcctctc
ggaccatatggccaggtccctggaccacgggcctgggataacatcactaccgaacacatc
atagacggcagcactatcagactctaccacatgactactgacagacgcctccactctcat
gatgttcgtcctccggttaccgaagccgattggcagcaggaagtttccgcctatggctac
gaaggatttgagggagacgccaatgacctcttccgcgtggaaattgtcccttccatgtct
gatggagcagaggcaaagaagaggctaaggacgatccagacgaagttcaagcttgtgcac
gttatgactggttgtgttttgttctcccataaagtgaaactgccagaatggggcttcgac
caacaagaggttacctgtgccaagggtggttccctgcccaacagcatctggtacattgaa
cagaacagccagcccgctctccctgatgacgttgagaaagtgaactacaagattcctaac
ttctttgccaaattctgggagcttcacaaggttatgtggaggacaaacgctggcctcgtc
aactctcatgcttgggactcacgtccaccatcctggcccatcttgtcccgtggtatcaac
ttctggggcagacaccaccgccacgtttacctcattggcaacccagtcatctggtggact
tctaccgctgcacttgtcatctgggtcctcttcaagggtattgccgttcttcgatggcag
cgcggcttcaaggactacaactatgtccacttcaagcgctttgattacgagattggccag
actcttctcggctgggctcttcactacttcccattctaccttatggcccgccagcttttc
ctccaccactatctcccagccttgtactttgcaatcctggcattctgtcagatctacgac
tttgtggctaacagatttaacaagccatccatctttggcaagctgttcaccgttgcattc
ttgtctctcagcgttgctgccttctgtatcctttcaccacttgcatacggcaacccttgg
actaaagacatgtgccagaggaccaagttgatccctacctgggactttgactgcaacctt
ttccataatgacctatcccaatatgctattcccgaagttgtcaacacctcggaagccgct
catacttccatcgcagccccacccgtacagcagcagcagcaacagcaaccgggagagcaa
gagcaggagcagcaacctgaacagcaggagaaccaagttcctgtccagcccgaatcacca
cagcagccgccggcagtggacccagagcttcgtaaagttcgtgaagtcgagtaccgcgat
tcagagggcaacatcctcagcgaggaacaagtcaaagtcctccaggaacagggagaaatc
tcctttgaaacccgatatgagactcgcactagagtaatcgataccgaaggccgagaactc
cccaaggaagctattatcgcccctgaacacccagacgtgcagggcgctaacccagaaacc
gttgctaaggacgaaccaaaggctccagctaacaagccagctgaggtcaagggagagaac
gagtcccccaaaaagaaagaaaataagccaaagcccgccagcgaggctaaggctgctaca
aactaa

DBGET integrated database retrieval system