KEGG   Arthroderma benhamiae: ARB_07505Help
Entry
ARB_07505         CDS       T01611                                 

Definition
uroporphyrinogen-III synthase (UroS), putative
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
abe  Arthroderma benhamiae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:abe00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 307 aa AA seqDB search
MSLLPVTKEIPIYFLKTKSTPHDGYEEHFSPSKGFKPCFIPVLEHKLNHNNLQKVKDLIL
SGAVAKQYGGIIFTSQRAVEGFSRMVQDEVGSEEAGTGEKLSGLILAHYNGLQRNTSDEN
GPSGGIREKLPLLFLVGEQHRDIIPKTLMSPSLDEEERIGVATMVVYETGVMESFGQDFL
AALEMEERADKANISAGNTSLHKQLIWVVVFSPSGCKVMLQHLGLLEEDQPEDHTSSVQA
PGKKRTPSRWSRFDYRIATIGPTTRDHLVSNFGVQPDVCAEKPSPGGLWEGIEPIIEEWK
RSREQDR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtctctattacctgttaccaaagagatcccgatatatttccttaaaacaaaatcaact
cctcatgatggctacgaggagcacttttcgccgtccaagggcttcaagccgtgtttcatc
ccggtcttggaacacaaattaaaccacaataacctacaaaaggtgaaagacttgatcctc
tcgggtgccgtggctaaacagtatggtggaataatattcactagccagagggcagttgaa
ggattctctcggatggtacaggatgaggtagggagcgaagaggcaggcaccggagagaaa
ctctctggcctaattctcgcccattataacggtctacagcggaatacatcagatgaaaat
gggccttcggggggtataagggaaaagctacctcttcttttccttgttggcgaacagcat
cgtgatataataccgaagacactcatgtcgccgtctctagacgaagaagagcgcatcgga
gttgctacgatggttgtctatgagaccggagtcatggagagctttgggcaggattttcta
gcagctcttgagatggaggaacgggctgataaggccaatatatctgcgggaaataccagt
ctgcataaacagttaatatgggttgtggtattctcaccttcagggtgtaaggtaatgctg
caacatttaggactcctagaggaagatcagccagaagaccatacgtcttcagtacaggcc
cctggaaagaagaggacaccgagcaggtggtcaaggtttgactatcgaattgcaaccatt
gggccgactacgagggaccatttggtctccaattttggggtccaaccggacgtatgtgct
gagaagccttcccctggcggcctgtgggagggaattgagcctattatagaagagtggaaa
aggtctagagagcaagacagataa

DBGET integrated database retrieval system