KEGG   Arthroderma benhamiae: ARB_07505Help
Entry
ARB_07505         CDS       T01611                                 

Definition
uroporphyrinogen-III synthase (UroS), putative
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
abe  Arthroderma benhamiae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ARB_07505
Enzymes [BR:abe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     ARB_07505
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 307 aa AA seqDB search
MSLLPVTKEIPIYFLKTKSTPHDGYEEHFSPSKGFKPCFIPVLEHKLNHNNLQKVKDLIL
SGAVAKQYGGIIFTSQRAVEGFSRMVQDEVGSEEAGTGEKLSGLILAHYNGLQRNTSDEN
GPSGGIREKLPLLFLVGEQHRDIIPKTLMSPSLDEEERIGVATMVVYETGVMESFGQDFL
AALEMEERADKANISAGNTSLHKQLIWVVVFSPSGCKVMLQHLGLLEEDQPEDHTSSVQA
PGKKRTPSRWSRFDYRIATIGPTTRDHLVSNFGVQPDVCAEKPSPGGLWEGIEPIIEEWK
RSREQDR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtctctattacctgttaccaaagagatcccgatatatttccttaaaacaaaatcaact
cctcatgatggctacgaggagcacttttcgccgtccaagggcttcaagccgtgtttcatc
ccggtcttggaacacaaattaaaccacaataacctacaaaaggtgaaagacttgatcctc
tcgggtgccgtggctaaacagtatggtggaataatattcactagccagagggcagttgaa
ggattctctcggatggtacaggatgaggtagggagcgaagaggcaggcaccggagagaaa
ctctctggcctaattctcgcccattataacggtctacagcggaatacatcagatgaaaat
gggccttcggggggtataagggaaaagctacctcttcttttccttgttggcgaacagcat
cgtgatataataccgaagacactcatgtcgccgtctctagacgaagaagagcgcatcgga
gttgctacgatggttgtctatgagaccggagtcatggagagctttgggcaggattttcta
gcagctcttgagatggaggaacgggctgataaggccaatatatctgcgggaaataccagt
ctgcataaacagttaatatgggttgtggtattctcaccttcagggtgtaaggtaatgctg
caacatttaggactcctagaggaagatcagccagaagaccatacgtcttcagtacaggcc
cctggaaagaagaggacaccgagcaggtggtcaaggtttgactatcgaattgcaaccatt
gggccgactacgagggaccatttggtctccaattttggggtccaaccggacgtatgtgct
gagaagccttcccctggcggcctgtgggagggaattgagcctattatagaagagtggaaa
aggtctagagagcaagacagataa

DBGET integrated database retrieval system