KEGG   Arthroderma benhamiae: ARB_07520Help
Entry
ARB_07520         CDS       T01611                                 

Definition
ubiquitin C-terminal hydrolase Ubp8, putative
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
abe  Arthroderma benhamiae
Brite
Enzymes [BR:abe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     ARB_07520
Peptidases [BR:abe01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   ARB_07520
Transcription machinery [BR:abe03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     ARB_07520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 489 aa AA seqDB search
MATLSTPLYEPAYGCGKCSFLHRKLKACILTFFRTEHLKDIFEKDTDAATRLAENYTKLS
GKGPWNISQIRLDASKKSSSGPKFSLKPQYQCLQCSAVVADYRSKHVFCQGCDDLIYDID
LESILKNSTEPIVSRKRKVDNMEDDEYANYIAMNTNKKICGKEGVRGLFNLGQTCYMNVI
LQTLFHEPVLTAYFLGNGHSTSECQKANCFGCALADAFAEFSNEEKDEGFGALNLLLASW
QTSSDLAGYHQQDAHEFYQFLVNQLHESTTGHLDCDPACRCFFHTAFFGKLRSTITCRNC
GKVSRTEDPVMDVSLDLQVQKKKRALDGGDQSSDVAPTLQGCLEGYISPEKLAASEYGCT
QCNSNMGVTKQLRLRKLPVILCMQLKRFERNRSVSEKVETKVTYPASINMMPYTTSPRSE
NRSQFQYDLLSVVVHIGDIDSGHYLAYCRHGEQWFKFNDDRVTVVAESEVLGADAYLLFY
TLQAYGVSK
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggctactctgtccactcctctttatgagccagcttatggctgtggtaagtgttcgttc
ctccataggaagctcaaagcatgcattttgaccttctttcgcacagaacacctcaaggat
atatttgagaaagacacagacgcagccaccagactcgctgagaactacaccaaactgagt
ggcaagggaccatggaacatatcgcaaattcgtcttgatgcctcgaaaaagagcagctct
gggccaaagttctccctgaaaccgcaataccagtgcctccaatgctcggctgtcgttgcc
gactacagaagcaaacatgtcttctgccaaggatgtgacgacctcatctacgatatcgac
ttggaaagcattttgaagaatagcactgagcctattgtctccagaaaacgcaaggtcgat
aatatggaggatgatgagtacgccaattacatcgctatgaataccaacaagaaaatttgc
ggcaaagaaggtgtcagaggactgttcaacctcggtcagacctgttatatgaatgttatt
ctccaaaccctattccacgaaccggtcttaacggcctacttccttgggaatgggcatagc
acgagcgagtgccagaaagcgaactgtttcggctgtgctctcgcagatgcttttgctgag
ttcagcaacgaagaaaaagacgagggcttcggtgccctcaaccttctccttgcctcgtgg
caaacatcctccgacctcgccggttaccaccagcaggacgcccacgaattttaccagttc
ttggtaaaccaactccacgagagcaccacagggcatctcgactgtgaccccgcctgtcgc
tgcttcttccacaccgcattcttcggcaaactacgaagcacaataacctgccgcaactgc
ggcaaggtttcccgcaccgaagacccagtgatggacgtcagccttgaccttcaggtccag
aagaagaagcgtgcccttgacggcggggatcaaagctccgacgttgcaccaaccctccag
gggtgcttggaagggtatatctcccctgaaaagcttgcagctagtgaatatggatgcacc
caatgtaactccaacatgggagttaccaagcaacttcgactacgaaagttgccagtcatc
ctctgcatgcaactgaagagattcgagcgcaatcgatctgtctccgaaaaggtcgaaacc
aaagtcacataccctgcctcgatcaatatgatgccatacaccaccagccctagatcagag
aaccggtcacagttccaatacgaccttttgagcgtcgttgtccacatcggcgatatcgac
tctggccactaccttgcttactgccggcacggtgaacagtggttcaaattcaatgatgac
cgtgtaactgtcgttgctgagtcggaggttcttggggctgacgcctatcttctcttctac
accttgcaggcatatggtgttagcaagtag

DBGET integrated database retrieval system