KEGG   Arthroderma benhamiae: ARB_07627Help
Entry
ARB_07627         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
abe  Arthroderma benhamiae
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:abe01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:abe00630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 654 aa AA seqDB search
MPRPDFHVGLKRRRHQHERTLEEINGNQQTRRKYDDDKDTIKEEGEGDHKITRSERNRML
RSVSRQLPRALRKPTPAFPTIRCISSTSLRMAPQLPAVRPPVSSALPSDSYQLLSTAEKA
GAAEDALFEEQIKAVNEWWASDRYEGIKRPYSAEAVVSKRGALQQTYPSSLMARKLFNLL
NERAAEGKPVHTLGAIDPVQMTQQAPNQEVLYISGWACSSLLTSTNEVSPDFGDYPYNTV
PNQVQRLFKAQNMHDRKHWDARRKLSPEERKNTPYIDYMRPIIADGDTGHGGLTAVMKLA
KLFAENGAAAVHFEDQLHGGKKCGHLAGKVLVPIAEHINRLVAARFQWDIMGTENLLIAR
TDSESGKLLSSTIDVRDHEFILGVTEDGDPLAETLQKMELEGASGAEIDVYEAQWVKKHK
LVTFDEAVDQHLIAEGASESVRNEYKSHVEQNRDLSISARRELAAKHTKNPVFWSWDIPR
TREGFYHYRAGNEAATKRAIAFAPYADLLWVETGDPNVSKAADFAGKIRKQFPGKKLVYN
LSPSFNWMGQGFTEQTLKSFIWDLAEHGFILQLISLAGLHYNATMATELSRGFKEDGMLS
YVNLVQKREKEMGVDVLTHQKWSGAPYVDGIVGSILSGSSSNKSMGEGNTEDRK
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgcctcggccggattttcacgtcggcctcaagcgccgaagacatcaacacgaacgaacc
ttggaagagatcaatggaaaccagcagacgaggagaaaatacgacgacgataaggacaca
attaaggaagaaggagaaggagatcacaagataacgaggagtgaaagaaacaggatgctt
cgctcagtgtcacgccagctgccgcgagctctccgcaagccgacacccgcattccccacg
atccgctgcatctccagcaccagcctgcgaatggccccccagctacccgctgtacgccct
cccgtatcatcggcgcttccatcagactcatatcagctcttatcaaccgctgagaaagcc
ggtgctgccgaagatgccctgtttgaagagcaaatcaaggccgtaaacgagtggtgggca
tccgacagatatgagggtatcaagagaccatactccgccgaggcagtggtgagcaagaga
ggagccttgcagcagacatatcccagctcgttgatggcgaggaaactcttcaacttgctg
aacgaacgagctgcggagggcaaaccagtccacactctgggagcaattgaccccgtacag
atgacccaacaagcaccaaaccaggaagtgctttatatatcaggatgggcatgctcatcg
cttcttacctccacgaacgaagtctcgccggactttggagactacccatacaacaccgtg
ccaaatcaggtacaacgcctgttcaaggcccagaacatgcacgacaggaaacattgggat
gccaggcgaaagctctcgccagaagagcgcaagaataccccatacatcgattacatgcgc
cctattattgcagatggtgatactggacacggcggcctcaccgcagtcatgaaactagcc
aaattgtttgccgagaacggcgccgcagccgtacactttgaggatcaattgcacggcggc
aagaagtgtggtcatcttgctggcaaggttctcgtaccgattgcggagcatattaacaga
ttggttgctgcccgtttccagtgggatatcatgggcaccgagaaccttcttatagcacga
acagattcagagagtggtaagttgctgagcagcaccatcgacgttcgggatcacgaattt
atcctcggtgtgactgaggacggtgaccccttggccgagacgctccagaaaatggagttg
gagggcgcatctggcgcagagatcgatgtttacgaagcccagtgggttaagaaacataaa
ctggttacattcgatgaagccgtggaccaacacctcatcgctgaaggtgcttctgagtca
gttagaaatgaatataaatcgcatgttgagcagaaccgtgatctttcgatctccgctcgc
cgtgagttggctgccaaacacacaaagaaccccgtcttctggtcctgggacatcccacgc
acccgcgaaggcttctatcattaccgtgctggcaatgaggcagctaccaagcgtgccatt
gcatttgccccctatgcagacctcctgtgggttgagaccggagaccccaacgttagcaaa
gctgccgactttgctggcaagatccgcaaacaattccctggcaagaagttggtgtacaac
ctgagcccctcgttcaactggatgggacaaggattcaccgagcagacccttaaatcattt
atttgggatttggcagagcacggattcattctccaacttatctccctcgctggtctgcac
tacaatgctacaatggctactgagctgtctcgtggattcaaggaagacggcatgctatct
tacgtcaatttggtgcagaaacgcgaaaaggagatgggtgttgatgtacttacacatcag
aaatggagcggagcgccgtatgtcgacggtattgtgggatctatcctcagcggtagcagc
tcaaacaagagcatgggtgaaggaaacactgaagaccgtaagtaa

DBGET integrated database retrieval system